BLASTX nr result
ID: Lithospermum23_contig00035239
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00035239 (270 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013442549.1 Ulp1 protease family, carboxy-terminal domain pro... 55 6e-07 >XP_013442549.1 Ulp1 protease family, carboxy-terminal domain protein [Medicago truncatula] KEH16574.1 Ulp1 protease family, carboxy-terminal domain protein [Medicago truncatula] Length = 842 Score = 55.5 bits (132), Expect = 6e-07 Identities = 24/45 (53%), Positives = 34/45 (75%), Gaps = 1/45 (2%) Frame = -1 Query: 135 GKRGETNVGQL-NTTSFGGILHICKWKKLNSFFVEWVVNKFEAKH 4 GKR + + QL N + FGG++HICKW K+++FFVEWVV FE ++ Sbjct: 80 GKRRKDQIIQLLNESGFGGMVHICKWTKIHTFFVEWVVKHFEKEN 124