BLASTX nr result
ID: Lithospermum23_contig00035002
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00035002 (429 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016574878.1 PREDICTED: tRNA-specific adenosine deaminase 2 [C... 61 7e-09 XP_015158477.1 PREDICTED: tRNA-specific adenosine deaminase 2 is... 61 8e-09 XP_015158475.1 PREDICTED: tRNA-specific adenosine deaminase 2 is... 61 8e-09 XP_015158474.1 PREDICTED: tRNA-specific adenosine deaminase 2 is... 61 9e-09 XP_015158473.1 PREDICTED: tRNA-specific adenosine deaminase 2 is... 61 1e-08 XP_019070494.1 PREDICTED: tRNA-specific adenosine deaminase 2 is... 61 1e-08 XP_015080945.1 PREDICTED: tRNA-specific adenosine deaminase 2 [S... 61 1e-08 XP_004242811.1 PREDICTED: tRNA-specific adenosine deaminase 2 is... 61 1e-08 XP_015582177.1 PREDICTED: tRNA-specific adenosine deaminase 2 is... 59 4e-08 KCW73941.1 hypothetical protein EUGRSUZ_E025301, partial [Eucaly... 56 4e-08 XP_015582176.1 PREDICTED: tRNA-specific adenosine deaminase 2 is... 59 5e-08 OMP07773.1 CMP/dCMP deaminase, zinc-binding protein [Corchorus o... 59 6e-08 OMO94394.1 CMP/dCMP deaminase, zinc-binding protein [Corchorus c... 59 6e-08 XP_015582175.1 PREDICTED: tRNA-specific adenosine deaminase 2 is... 59 6e-08 XP_015582174.1 PREDICTED: tRNA-specific adenosine deaminase 2 is... 59 6e-08 XP_012083736.1 PREDICTED: tRNA-specific adenosine deaminase 2-li... 59 6e-08 XP_006453251.1 hypothetical protein CICLE_v10009594mg [Citrus cl... 59 7e-08 XP_015582173.1 PREDICTED: tRNA-specific adenosine deaminase 2 is... 59 7e-08 XP_012083662.1 PREDICTED: tRNA-specific adenosine deaminase 2-li... 59 8e-08 XP_010252288.1 PREDICTED: tRNA-specific adenosine deaminase 2 is... 59 8e-08 >XP_016574878.1 PREDICTED: tRNA-specific adenosine deaminase 2 [Capsicum annuum] Length = 185 Score = 61.2 bits (147), Expect = 7e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 419 AKKGFKCTGGVMASEAVSLLRMFYEQGNPN 330 +KKGFKCTGG+MASEAVSLLR FYEQGNPN Sbjct: 144 SKKGFKCTGGIMASEAVSLLRSFYEQGNPN 173 >XP_015158477.1 PREDICTED: tRNA-specific adenosine deaminase 2 isoform X4 [Solanum tuberosum] Length = 190 Score = 61.2 bits (147), Expect = 8e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 419 AKKGFKCTGGVMASEAVSLLRMFYEQGNPN 330 +KKGFKCTGG+MASEAVSLLR FYEQGNPN Sbjct: 149 SKKGFKCTGGIMASEAVSLLRSFYEQGNPN 178 >XP_015158475.1 PREDICTED: tRNA-specific adenosine deaminase 2 isoform X3 [Solanum tuberosum] XP_015158476.1 PREDICTED: tRNA-specific adenosine deaminase 2 isoform X3 [Solanum tuberosum] Length = 191 Score = 61.2 bits (147), Expect = 8e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 419 AKKGFKCTGGVMASEAVSLLRMFYEQGNPN 330 +KKGFKCTGG+MASEAVSLLR FYEQGNPN Sbjct: 150 SKKGFKCTGGIMASEAVSLLRSFYEQGNPN 179 >XP_015158474.1 PREDICTED: tRNA-specific adenosine deaminase 2 isoform X2 [Solanum tuberosum] Length = 201 Score = 61.2 bits (147), Expect = 9e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 419 AKKGFKCTGGVMASEAVSLLRMFYEQGNPN 330 +KKGFKCTGG+MASEAVSLLR FYEQGNPN Sbjct: 160 SKKGFKCTGGIMASEAVSLLRSFYEQGNPN 189 >XP_015158473.1 PREDICTED: tRNA-specific adenosine deaminase 2 isoform X1 [Solanum tuberosum] Length = 206 Score = 61.2 bits (147), Expect = 1e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 419 AKKGFKCTGGVMASEAVSLLRMFYEQGNPN 330 +KKGFKCTGG+MASEAVSLLR FYEQGNPN Sbjct: 165 SKKGFKCTGGIMASEAVSLLRSFYEQGNPN 194 >XP_019070494.1 PREDICTED: tRNA-specific adenosine deaminase 2 isoform X2 [Solanum lycopersicum] Length = 211 Score = 61.2 bits (147), Expect = 1e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 419 AKKGFKCTGGVMASEAVSLLRMFYEQGNPN 330 +KKGFKCTGG+MASEAVSLLR FYEQGNPN Sbjct: 170 SKKGFKCTGGIMASEAVSLLRSFYEQGNPN 199 >XP_015080945.1 PREDICTED: tRNA-specific adenosine deaminase 2 [Solanum pennellii] Length = 212 Score = 61.2 bits (147), Expect = 1e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 419 AKKGFKCTGGVMASEAVSLLRMFYEQGNPN 330 +KKGFKCTGG+MASEAVSLLR FYEQGNPN Sbjct: 171 SKKGFKCTGGIMASEAVSLLRSFYEQGNPN 200 >XP_004242811.1 PREDICTED: tRNA-specific adenosine deaminase 2 isoform X1 [Solanum lycopersicum] Length = 212 Score = 61.2 bits (147), Expect = 1e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 419 AKKGFKCTGGVMASEAVSLLRMFYEQGNPN 330 +KKGFKCTGG+MASEAVSLLR FYEQGNPN Sbjct: 171 SKKGFKCTGGIMASEAVSLLRSFYEQGNPN 200 >XP_015582177.1 PREDICTED: tRNA-specific adenosine deaminase 2 isoform X5 [Ricinus communis] Length = 169 Score = 58.9 bits (141), Expect = 4e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -2 Query: 413 KGFKCTGGVMASEAVSLLRMFYEQGNPN 330 KGFKCTGG+MASEAVSLLR FYEQGNPN Sbjct: 127 KGFKCTGGIMASEAVSLLRCFYEQGNPN 154 >KCW73941.1 hypothetical protein EUGRSUZ_E025301, partial [Eucalyptus grandis] Length = 46 Score = 55.8 bits (133), Expect = 4e-08 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -2 Query: 413 KGFKCTGGVMASEAVSLLRMFYEQGNPN 330 KGFKC GG+MASEAVSLLR FYEQGNPN Sbjct: 7 KGFKCCGGIMASEAVSLLRDFYEQGNPN 34 >XP_015582176.1 PREDICTED: tRNA-specific adenosine deaminase 2 isoform X4 [Ricinus communis] Length = 181 Score = 58.9 bits (141), Expect = 5e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -2 Query: 413 KGFKCTGGVMASEAVSLLRMFYEQGNPN 330 KGFKCTGG+MASEAVSLLR FYEQGNPN Sbjct: 139 KGFKCTGGIMASEAVSLLRCFYEQGNPN 166 >OMP07773.1 CMP/dCMP deaminase, zinc-binding protein [Corchorus olitorius] Length = 190 Score = 58.9 bits (141), Expect = 6e-08 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -2 Query: 416 KKGFKCTGGVMASEAVSLLRMFYEQGNPN 330 +KGFKCTGG+MASEAVSLLR FYEQGNPN Sbjct: 149 RKGFKCTGGLMASEAVSLLRSFYEQGNPN 177 >OMO94394.1 CMP/dCMP deaminase, zinc-binding protein [Corchorus capsularis] Length = 191 Score = 58.9 bits (141), Expect = 6e-08 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -2 Query: 416 KKGFKCTGGVMASEAVSLLRMFYEQGNPN 330 +KGFKCTGG+MASEAVSLLR FYEQGNPN Sbjct: 149 RKGFKCTGGLMASEAVSLLRSFYEQGNPN 177 >XP_015582175.1 PREDICTED: tRNA-specific adenosine deaminase 2 isoform X3 [Ricinus communis] Length = 192 Score = 58.9 bits (141), Expect = 6e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -2 Query: 413 KGFKCTGGVMASEAVSLLRMFYEQGNPN 330 KGFKCTGG+MASEAVSLLR FYEQGNPN Sbjct: 150 KGFKCTGGIMASEAVSLLRCFYEQGNPN 177 >XP_015582174.1 PREDICTED: tRNA-specific adenosine deaminase 2 isoform X2 [Ricinus communis] Length = 193 Score = 58.9 bits (141), Expect = 6e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -2 Query: 413 KGFKCTGGVMASEAVSLLRMFYEQGNPN 330 KGFKCTGG+MASEAVSLLR FYEQGNPN Sbjct: 151 KGFKCTGGIMASEAVSLLRCFYEQGNPN 178 >XP_012083736.1 PREDICTED: tRNA-specific adenosine deaminase 2-like isoform X2 [Jatropha curcas] Length = 224 Score = 59.3 bits (142), Expect = 6e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 413 KGFKCTGGVMASEAVSLLRMFYEQGNPN 330 KGFKCTGGVMASEAVSLLR FYEQGNPN Sbjct: 182 KGFKCTGGVMASEAVSLLRCFYEQGNPN 209 >XP_006453251.1 hypothetical protein CICLE_v10009594mg [Citrus clementina] ESR66491.1 hypothetical protein CICLE_v10009594mg [Citrus clementina] KDO61913.1 hypothetical protein CISIN_1g029549mg [Citrus sinensis] Length = 179 Score = 58.5 bits (140), Expect = 7e-08 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -2 Query: 416 KKGFKCTGGVMASEAVSLLRMFYEQGNPN 330 +KGFKCTGGVMASEAVSL R FYEQGNPN Sbjct: 149 RKGFKCTGGVMASEAVSLFRSFYEQGNPN 177 >XP_015582173.1 PREDICTED: tRNA-specific adenosine deaminase 2 isoform X1 [Ricinus communis] Length = 203 Score = 58.9 bits (141), Expect = 7e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -2 Query: 413 KGFKCTGGVMASEAVSLLRMFYEQGNPN 330 KGFKCTGG+MASEAVSLLR FYEQGNPN Sbjct: 161 KGFKCTGGIMASEAVSLLRCFYEQGNPN 188 >XP_012083662.1 PREDICTED: tRNA-specific adenosine deaminase 2-like isoform X1 [Jatropha curcas] KDP46965.1 hypothetical protein JCGZ_07982 [Jatropha curcas] Length = 244 Score = 59.3 bits (142), Expect = 8e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 413 KGFKCTGGVMASEAVSLLRMFYEQGNPN 330 KGFKCTGGVMASEAVSLLR FYEQGNPN Sbjct: 202 KGFKCTGGVMASEAVSLLRCFYEQGNPN 229 >XP_010252288.1 PREDICTED: tRNA-specific adenosine deaminase 2 isoform X2 [Nelumbo nucifera] Length = 188 Score = 58.5 bits (140), Expect = 8e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -2 Query: 413 KGFKCTGGVMASEAVSLLRMFYEQGNPN 330 KGFKCTGG+MASEA+SLLR FYEQGNPN Sbjct: 150 KGFKCTGGIMASEAISLLRSFYEQGNPN 177