BLASTX nr result
ID: Lithospermum23_contig00035000
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00035000 (530 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIT01951.1 hypothetical protein A4A49_03447 [Nicotiana attenuata] 56 2e-06 >OIT01951.1 hypothetical protein A4A49_03447 [Nicotiana attenuata] Length = 216 Score = 56.2 bits (134), Expect = 2e-06 Identities = 22/43 (51%), Positives = 30/43 (69%) Frame = +2 Query: 401 LFVLFLAINCALCYGSGHIKSNQLCSQCSVCDTNKCPPSESYP 529 + +L L + C + + +KS LCSQCS C+TNKCPPSE+YP Sbjct: 5 ILLLVLLMTCGISDATAELKSKLLCSQCSKCETNKCPPSEAYP 47