BLASTX nr result
ID: Lithospermum23_contig00034904
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00034904 (334 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019185237.1 PREDICTED: methyl-CpG-binding domain-containing p... 53 8e-06 >XP_019185237.1 PREDICTED: methyl-CpG-binding domain-containing protein 9-like [Ipomoea nil] Length = 1817 Score = 53.1 bits (126), Expect = 8e-06 Identities = 28/56 (50%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = +1 Query: 169 AVDIVLTFHNSYKVPSSDVAELVEVV-GDAVCGSCGGIEGKGEVIVCDRCEIGFHV 333 A +V +FH S K+PS AEL + G A C +CG E +G V+VCD CE GFHV Sbjct: 45 AEKLVRSFHTSTKLPSGAPAELSRKLNGSASCEACGRPEAEGCVVVCDGCERGFHV 100