BLASTX nr result
ID: Lithospermum23_contig00034852
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00034852 (211 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ADP88725.1 reverse transcriptase, partial [Fragaria orientalis] 100 2e-26 ABF57072.1 reverse transcriptase, partial [Prunus mume] 99 2e-25 AAK84842.1 reverse transcriptase, partial [Zea mays] 98 4e-25 GAU46175.1 hypothetical protein TSUD_93620 [Trifolium subterraneum] 105 9e-25 XP_014489926.1 PREDICTED: uncharacterized mitochondrial protein ... 102 9e-25 AFS30564.1 reverse transcriptase, partial [Petunia x hybrida] 96 1e-24 AOG75316.1 reverse transcriptase [Mirabilis jalapa] 101 1e-24 KYP76316.1 Retrovirus-related Pol polyprotein from transposon TN... 102 1e-24 ADF45894.1 reverse transcriptase, partial [Eleocharis quinqueflora] 96 2e-24 ADE44142.1 reverse transcriptase, partial [Corchorus olitorius] 94 7e-24 ADE44140.1 reverse transcriptase, partial [Corchorus olitorius] 94 7e-24 ADF45803.1 reverse transcriptase, partial [Eleocharis cellulosa]... 94 7e-24 ACZ36935.1 reverse transcriptase, partial [Prunus mume] 94 7e-24 KYP63355.1 Retrovirus-related Pol polyprotein from transposon TN... 102 8e-24 KYP64614.1 Retrovirus-related Pol polyprotein from transposon TN... 102 8e-24 JAU92359.1 putative mitochondrial protein, partial [Noccaea caer... 98 8e-24 XP_017180445.1 PREDICTED: uncharacterized mitochondrial protein ... 100 9e-24 ADF45829.1 reverse transcriptase, partial [Eleocharis erythropoda] 94 1e-23 ADF45881.1 reverse transcriptase, partial [Eleocharis palustris] 94 1e-23 ADF45847.1 reverse transcriptase, partial [Eleocharis macrostachya] 94 1e-23 >ADP88725.1 reverse transcriptase, partial [Fragaria orientalis] Length = 88 Score = 100 bits (250), Expect = 2e-26 Identities = 48/65 (73%), Positives = 51/65 (78%) Frame = -3 Query: 197 AFLHGSLTETVYMTQPPGFVDIHFPQHVCRLHKSLYGLKQAPRAWFSC*HDFLLTYGFLQ 18 AFLHG L E VYM QPPGFVD P +VC+LHKSLYGLKQAPRAWF C FLL+ GF Q Sbjct: 2 AFLHGYLQEDVYMIQPPGFVDPSQPSYVCKLHKSLYGLKQAPRAWFQCMSKFLLSVGFRQ 61 Query: 17 SKADS 3 SKADS Sbjct: 62 SKADS 66 >ABF57072.1 reverse transcriptase, partial [Prunus mume] Length = 88 Score = 98.6 bits (244), Expect = 2e-25 Identities = 46/65 (70%), Positives = 49/65 (75%) Frame = -3 Query: 197 AFLHGSLTETVYMTQPPGFVDIHFPQHVCRLHKSLYGLKQAPRAWFSC*HDFLLTYGFLQ 18 AFLHG LTE VYM QPPGFVD P HVC+LHK++YGLKQAPRAWF C FLL GF Sbjct: 2 AFLHGLLTEEVYMQQPPGFVDPSHPHHVCKLHKAIYGLKQAPRAWFHCFSSFLLRVGFDN 61 Query: 17 SKADS 3 SK DS Sbjct: 62 SKDDS 66 >AAK84842.1 reverse transcriptase, partial [Zea mays] Length = 94 Score = 97.8 bits (242), Expect = 4e-25 Identities = 43/69 (62%), Positives = 55/69 (79%) Frame = -3 Query: 209 DIQNAFLHGSLTETVYMTQPPGFVDIHFPQHVCRLHKSLYGLKQAPRAWFSC*HDFLLTY 30 D++ AFLHG+LTETVY TQP GF+D P HVCRL+KSLYGLKQAPRAW+SC + + Sbjct: 3 DVKTAFLHGTLTETVYCTQPAGFLDPAHPDHVCRLNKSLYGLKQAPRAWYSCFASRIQSM 62 Query: 29 GFLQSKADS 3 GF+++K D+ Sbjct: 63 GFIEAKTDT 71 >GAU46175.1 hypothetical protein TSUD_93620 [Trifolium subterraneum] Length = 683 Score = 105 bits (261), Expect = 9e-25 Identities = 44/68 (64%), Positives = 56/68 (82%) Frame = -3 Query: 209 DIQNAFLHGSLTETVYMTQPPGFVDIHFPQHVCRLHKSLYGLKQAPRAWFSC*HDFLLTY 30 D+ NAFL+G+L E VYM+QPPGFV +P HVC+LHKSLYGLKQAP AW++ H F++TY Sbjct: 551 DVNNAFLNGTLNEEVYMSQPPGFVHSSYPNHVCKLHKSLYGLKQAPHAWYNALHSFVVTY 610 Query: 29 GFLQSKAD 6 GF +SK+D Sbjct: 611 GFFKSKSD 618 >XP_014489926.1 PREDICTED: uncharacterized mitochondrial protein AtMg00810-like [Vigna radiata var. radiata] Length = 309 Score = 102 bits (254), Expect = 9e-25 Identities = 42/69 (60%), Positives = 58/69 (84%) Frame = -3 Query: 209 DIQNAFLHGSLTETVYMTQPPGFVDIHFPQHVCRLHKSLYGLKQAPRAWFSC*HDFLLTY 30 D+ NAFLHG+++E +YM+QPPGFV FP +VC+LHKSLYGLKQAPRAW++ +FL++Y Sbjct: 2 DVNNAFLHGTISEDLYMSQPPGFVHPQFPTYVCKLHKSLYGLKQAPRAWYNALRNFLISY 61 Query: 29 GFLQSKADS 3 GF S++D+ Sbjct: 62 GFTNSRSDT 70 >AFS30564.1 reverse transcriptase, partial [Petunia x hybrida] Length = 87 Score = 96.3 bits (238), Expect = 1e-24 Identities = 44/65 (67%), Positives = 49/65 (75%) Frame = -3 Query: 197 AFLHGSLTETVYMTQPPGFVDIHFPQHVCRLHKSLYGLKQAPRAWFSC*HDFLLTYGFLQ 18 AFLHG LTE VYM+QP GF D +P HVCRLHK+LYGLKQAPRAWF L YGF+ Sbjct: 2 AFLHGQLTEEVYMSQPAGFTDPRYPTHVCRLHKALYGLKQAPRAWFERLSSALFEYGFVS 61 Query: 17 SKADS 3 SK+DS Sbjct: 62 SKSDS 66 >AOG75316.1 reverse transcriptase [Mirabilis jalapa] Length = 272 Score = 101 bits (251), Expect = 1e-24 Identities = 45/69 (65%), Positives = 55/69 (79%) Frame = -3 Query: 209 DIQNAFLHGSLTETVYMTQPPGFVDIHFPQHVCRLHKSLYGLKQAPRAWFSC*HDFLLTY 30 D++NAFLHG+LTETVY TQPPGFVD FP VCRL+K+LYGLKQAPR+WF C + + Sbjct: 136 DVKNAFLHGTLTETVYCTQPPGFVDKRFPDSVCRLNKALYGLKQAPRSWFQCFAAYATSL 195 Query: 29 GFLQSKADS 3 GF + K+DS Sbjct: 196 GFRRCKSDS 204 >KYP76316.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 340 Score = 102 bits (254), Expect = 1e-24 Identities = 47/68 (69%), Positives = 54/68 (79%) Frame = -3 Query: 209 DIQNAFLHGSLTETVYMTQPPGFVDIHFPQHVCRLHKSLYGLKQAPRAWFSC*HDFLLTY 30 D++NAFLHG LTE VYM QPPGFVD FP HVCRL+K+LYGLKQAPRAWF FL+ Sbjct: 110 DVKNAFLHGHLTEIVYMEQPPGFVDPRFPTHVCRLNKALYGLKQAPRAWFQRLSSFLMRS 169 Query: 29 GFLQSKAD 6 GF+ S+AD Sbjct: 170 GFICSRAD 177 >ADF45894.1 reverse transcriptase, partial [Eleocharis quinqueflora] Length = 87 Score = 95.5 bits (236), Expect = 2e-24 Identities = 43/64 (67%), Positives = 49/64 (76%) Frame = -3 Query: 197 AFLHGSLTETVYMTQPPGFVDIHFPQHVCRLHKSLYGLKQAPRAWFSC*HDFLLTYGFLQ 18 AF HG LTETV+MTQPPGF D HFP HVC+L K++YGLKQ+PRAWF LLTYGF Sbjct: 2 AFFHGKLTETVFMTQPPGFTDPHFPIHVCKLSKAIYGLKQSPRAWFQTLSTALLTYGFQA 61 Query: 17 SKAD 6 S+ D Sbjct: 62 SQFD 65 >ADE44142.1 reverse transcriptase, partial [Corchorus olitorius] Length = 87 Score = 94.4 bits (233), Expect = 7e-24 Identities = 43/65 (66%), Positives = 51/65 (78%) Frame = -3 Query: 197 AFLHGSLTETVYMTQPPGFVDIHFPQHVCRLHKSLYGLKQAPRAWFSC*HDFLLTYGFLQ 18 AFLHG L ETVYM QPPGF+D P +VC+L K+LYGLKQAPRAW++ FLL YGF Q Sbjct: 2 AFLHGQLQETVYMKQPPGFIDQSNPTYVCKLDKALYGLKQAPRAWYTTLKSFLLQYGFSQ 61 Query: 17 SKADS 3 S++DS Sbjct: 62 SRSDS 66 >ADE44140.1 reverse transcriptase, partial [Corchorus olitorius] Length = 87 Score = 94.4 bits (233), Expect = 7e-24 Identities = 43/65 (66%), Positives = 51/65 (78%) Frame = -3 Query: 197 AFLHGSLTETVYMTQPPGFVDIHFPQHVCRLHKSLYGLKQAPRAWFSC*HDFLLTYGFLQ 18 AFLHG L ETVYM QPPGF+D P +VC+L K+LYGLKQAPRAW++ FLL YGF Q Sbjct: 2 AFLHGQLQETVYMKQPPGFIDQSNPTYVCKLDKALYGLKQAPRAWYTTLKSFLLQYGFSQ 61 Query: 17 SKADS 3 S++DS Sbjct: 62 SRSDS 66 >ADF45803.1 reverse transcriptase, partial [Eleocharis cellulosa] ADF45804.1 reverse transcriptase, partial [Eleocharis cellulosa] Length = 88 Score = 94.4 bits (233), Expect = 7e-24 Identities = 44/64 (68%), Positives = 48/64 (75%) Frame = -3 Query: 197 AFLHGSLTETVYMTQPPGFVDIHFPQHVCRLHKSLYGLKQAPRAWFSC*HDFLLTYGFLQ 18 AFLHG LTETVYMTQP GF+D +P HVC LHKSLYGLKQAPRAWF LL++GF Sbjct: 2 AFLHGDLTETVYMTQPQGFIDPQYPNHVCLLHKSLYGLKQAPRAWFEKLSTTLLSFGFKS 61 Query: 17 SKAD 6 S D Sbjct: 62 STYD 65 >ACZ36935.1 reverse transcriptase, partial [Prunus mume] Length = 88 Score = 94.4 bits (233), Expect = 7e-24 Identities = 42/65 (64%), Positives = 52/65 (80%) Frame = -3 Query: 197 AFLHGSLTETVYMTQPPGFVDIHFPQHVCRLHKSLYGLKQAPRAWFSC*HDFLLTYGFLQ 18 AFLHG L+E V+M QPPGF+D P HVC+LHK++YGLKQAPRAWF +FLL GF+Q Sbjct: 2 AFLHGYLSEAVFMQQPPGFIDPERPTHVCKLHKAIYGLKQAPRAWFQRFGNFLLQAGFIQ 61 Query: 17 SKADS 3 S++DS Sbjct: 62 SRSDS 66 >KYP63355.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1040 Score = 102 bits (254), Expect = 8e-24 Identities = 47/68 (69%), Positives = 54/68 (79%) Frame = -3 Query: 209 DIQNAFLHGSLTETVYMTQPPGFVDIHFPQHVCRLHKSLYGLKQAPRAWFSC*HDFLLTY 30 D++NAFLHG LTETVYM QP GFVD F HVCRL+K+LYGLKQAPRAWF C FL+ Sbjct: 852 DVKNAFLHGHLTETVYMEQPSGFVDPRFLTHVCRLNKALYGLKQAPRAWFQCLSSFLMRS 911 Query: 29 GFLQSKAD 6 GF+ S+AD Sbjct: 912 GFICSRAD 919 >KYP64614.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 1291 Score = 102 bits (254), Expect = 8e-24 Identities = 47/68 (69%), Positives = 54/68 (79%) Frame = -3 Query: 209 DIQNAFLHGSLTETVYMTQPPGFVDIHFPQHVCRLHKSLYGLKQAPRAWFSC*HDFLLTY 30 D++NAFLHG LTE VYM QPPGFVD FP HVCRL+K+LYGLKQAPRAWF FL+ Sbjct: 885 DVKNAFLHGHLTEIVYMEQPPGFVDPRFPTHVCRLNKALYGLKQAPRAWFQRLSSFLMRS 944 Query: 29 GFLQSKAD 6 GF+ S+AD Sbjct: 945 GFICSRAD 952 >JAU92359.1 putative mitochondrial protein, partial [Noccaea caerulescens] Length = 229 Score = 98.2 bits (243), Expect = 8e-24 Identities = 45/68 (66%), Positives = 52/68 (76%) Frame = -3 Query: 209 DIQNAFLHGSLTETVYMTQPPGFVDIHFPQHVCRLHKSLYGLKQAPRAWFSC*HDFLLTY 30 D++NAFLHG L ETVYM QP GFVD P HVC LHK++YGLKQAPRAWF +FLL + Sbjct: 9 DVKNAFLHGDLAETVYMQQPAGFVDKAHPDHVCLLHKAIYGLKQAPRAWFDKFSNFLLEF 68 Query: 29 GFLQSKAD 6 GF+ SK D Sbjct: 69 GFVCSKLD 76 >XP_017180445.1 PREDICTED: uncharacterized mitochondrial protein AtMg00810-like [Malus domestica] Length = 380 Score = 100 bits (250), Expect = 9e-24 Identities = 46/69 (66%), Positives = 53/69 (76%) Frame = -3 Query: 209 DIQNAFLHGSLTETVYMTQPPGFVDIHFPQHVCRLHKSLYGLKQAPRAWFSC*HDFLLTY 30 D++NAFLHG L E VYM+QPPGF+D P HVCRL K+LYGLKQAPR WF +L Y Sbjct: 93 DVKNAFLHGHLKEEVYMSQPPGFIDPQRPHHVCRLTKALYGLKQAPRPWFHRFSSYLFCY 152 Query: 29 GFLQSKADS 3 GFLQSKAD+ Sbjct: 153 GFLQSKADN 161 >ADF45829.1 reverse transcriptase, partial [Eleocharis erythropoda] Length = 87 Score = 94.0 bits (232), Expect = 1e-23 Identities = 43/65 (66%), Positives = 52/65 (80%) Frame = -3 Query: 197 AFLHGSLTETVYMTQPPGFVDIHFPQHVCRLHKSLYGLKQAPRAWFSC*HDFLLTYGFLQ 18 AFLHG L ETVYM QPPGFVD + P HVC+L+K++YGLKQAPR+WFS FL T+ F+ Sbjct: 2 AFLHGDLAETVYMEQPPGFVDQNCPHHVCKLNKAIYGLKQAPRSWFSRLKAFLQTHKFVS 61 Query: 17 SKADS 3 SKAD+ Sbjct: 62 SKADT 66 >ADF45881.1 reverse transcriptase, partial [Eleocharis palustris] Length = 88 Score = 94.0 bits (232), Expect = 1e-23 Identities = 42/65 (64%), Positives = 52/65 (80%) Frame = -3 Query: 197 AFLHGSLTETVYMTQPPGFVDIHFPQHVCRLHKSLYGLKQAPRAWFSC*HDFLLTYGFLQ 18 AF HG L ETVYM QPPGFVD ++PQHVC+L+K++YGLKQAPR+WFS FL + F+ Sbjct: 2 AFFHGDLLETVYMEQPPGFVDQNYPQHVCKLNKAIYGLKQAPRSWFSKLKTFLHAHKFVS 61 Query: 17 SKADS 3 SKAD+ Sbjct: 62 SKADT 66 >ADF45847.1 reverse transcriptase, partial [Eleocharis macrostachya] Length = 88 Score = 94.0 bits (232), Expect = 1e-23 Identities = 43/65 (66%), Positives = 52/65 (80%) Frame = -3 Query: 197 AFLHGSLTETVYMTQPPGFVDIHFPQHVCRLHKSLYGLKQAPRAWFSC*HDFLLTYGFLQ 18 AFLHG L ETVYM QPPGFVD + P HVC+L+K++YGLKQAPR+WFS FL T+ F+ Sbjct: 2 AFLHGDLAETVYMEQPPGFVDQNCPHHVCKLNKAIYGLKQAPRSWFSRLKAFLQTHKFVS 61 Query: 17 SKADS 3 SKAD+ Sbjct: 62 SKADT 66