BLASTX nr result
ID: Lithospermum23_contig00034426
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00034426 (266 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAV08136.1 putative conserved secreted protein precursor [Nyssom... 54 2e-06 JAV03085.1 putative conserved plasma membrane protein, partial [... 54 2e-06 BAT13426.1 Os11g0247300, partial [Oryza sativa Japonica Group] 50 2e-06 ABW24374.1 alpha-tubulin, partial [Riftia pachyptila] 50 2e-06 Q08628.1 RecName: Full=Tubulin alpha chain AAB27144.1 alpha-tubu... 50 3e-06 KNC35498.1 alpha-tubulin [Plasmodium falciparum RAJ116] 50 3e-06 ETK93299.1 tubulin alpha-2 chain, partial [Phytophthora parasitica] 50 3e-06 CDQ84910.1 unnamed protein product [Oncorhynchus mykiss] 50 3e-06 ABZ89827.1 alpha-tubulin transcript variant 4, partial [Octopus ... 50 3e-06 ABZ89819.1 alpha-tubulin transcript variant 1, partial [Octopus ... 50 3e-06 KOO23571.1 hypothetical protein Ctob_009807 [Chrysochromulina sp... 50 3e-06 CBY35662.1 unnamed protein product [Oikopleura dioica] 50 3e-06 AAK49527.1 alpha-tubulin, partial [Pinus taeda] 50 3e-06 ABS72026.1 putative alpha-tubulin, partial [Olea europaea] 50 3e-06 EJK73857.1 hypothetical protein THAOC_04498, partial [Thalassios... 50 4e-06 KXJ20904.1 Tubulin alpha-3 chain [Exaiptasia pallida] 50 4e-06 ELU10530.1 hypothetical protein CAPTEDRAFT_110222, partial [Capi... 50 4e-06 ETE58761.1 Tubulin alpha-8 chain [Ophiophagus hannah] 50 4e-06 XP_019781823.1 PREDICTED: tubulin alpha chain [Tursiops truncatus] 50 4e-06 XP_017299989.1 PREDICTED: tubulin alpha chain [Diaphorina citri]... 50 4e-06 >JAV08136.1 putative conserved secreted protein precursor [Nyssomyia neivai] Length = 450 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/42 (57%), Positives = 32/42 (76%) Frame = +1 Query: 139 LVLITFIILSLGRLSTNFFIILLKRSQILPCLGELAFLHTLT 264 L+ ++ +IL+L R+ TNF +ILL+ SQIL C GE FLHTLT Sbjct: 6 LIFLSTLILTLSRIHTNFLVILLEGSQILTCFGEFTFLHTLT 47 >JAV03085.1 putative conserved plasma membrane protein, partial [Nyssomyia neivai] Length = 516 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/42 (57%), Positives = 32/42 (76%) Frame = +1 Query: 139 LVLITFIILSLGRLSTNFFIILLKRSQILPCLGELAFLHTLT 264 L+ ++ +IL+L R+ TNF +ILL+ SQIL C GE FLHTLT Sbjct: 72 LIFLSTLILTLSRIHTNFLVILLEGSQILTCFGEFTFLHTLT 113 >BAT13426.1 Os11g0247300, partial [Oryza sativa Japonica Group] Length = 43 Score = 49.7 bits (117), Expect = 2e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 264 GEGMEEGEFSEAREDLAALEKDY 196 GEGMEEGEFSEAREDLAALEKDY Sbjct: 2 GEGMEEGEFSEAREDLAALEKDY 24 >ABW24374.1 alpha-tubulin, partial [Riftia pachyptila] Length = 43 Score = 49.7 bits (117), Expect = 2e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 264 GEGMEEGEFSEAREDLAALEKDY 196 GEGMEEGEFSEAREDLAALEKDY Sbjct: 2 GEGMEEGEFSEAREDLAALEKDY 24 >Q08628.1 RecName: Full=Tubulin alpha chain AAB27144.1 alpha-tubulin, partial [Blepharisma japonicum] Length = 50 Score = 49.7 bits (117), Expect = 3e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 264 GEGMEEGEFSEAREDLAALEKDY 196 GEGMEEGEFSEAREDLAALEKDY Sbjct: 7 GEGMEEGEFSEAREDLAALEKDY 29 >KNC35498.1 alpha-tubulin [Plasmodium falciparum RAJ116] Length = 52 Score = 49.7 bits (117), Expect = 3e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 264 GEGMEEGEFSEAREDLAALEKDY 196 GEGMEEGEFSEAREDLAALEKDY Sbjct: 12 GEGMEEGEFSEAREDLAALEKDY 34 >ETK93299.1 tubulin alpha-2 chain, partial [Phytophthora parasitica] Length = 52 Score = 49.7 bits (117), Expect = 3e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 264 GEGMEEGEFSEAREDLAALEKDY 196 GEGMEEGEFSEAREDLAALEKDY Sbjct: 9 GEGMEEGEFSEAREDLAALEKDY 31 >CDQ84910.1 unnamed protein product [Oncorhynchus mykiss] Length = 53 Score = 49.7 bits (117), Expect = 3e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 264 GEGMEEGEFSEAREDLAALEKDY 196 GEGMEEGEFSEAREDLAALEKDY Sbjct: 13 GEGMEEGEFSEAREDLAALEKDY 35 >ABZ89827.1 alpha-tubulin transcript variant 4, partial [Octopus bimaculoides] ABZ89830.1 alpha-tubulin transcript variant 5, partial [Octopus bimaculoides] Length = 53 Score = 49.7 bits (117), Expect = 3e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 264 GEGMEEGEFSEAREDLAALEKDY 196 GEGMEEGEFSEAREDLAALEKDY Sbjct: 13 GEGMEEGEFSEAREDLAALEKDY 35 >ABZ89819.1 alpha-tubulin transcript variant 1, partial [Octopus bimaculoides] ABZ89820.1 alpha-tubulin transcript variant 6, partial [Octopus bimaculoides] ABZ89821.1 alpha-tubulin transcript variant 7, partial [Octopus bimaculoides] ABZ89828.1 alpha-tubulin transcript variant 2, partial [Octopus bimaculoides] Length = 53 Score = 49.7 bits (117), Expect = 3e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 264 GEGMEEGEFSEAREDLAALEKDY 196 GEGMEEGEFSEAREDLAALEKDY Sbjct: 13 GEGMEEGEFSEAREDLAALEKDY 35 >KOO23571.1 hypothetical protein Ctob_009807 [Chrysochromulina sp. CCMP291] Length = 54 Score = 49.7 bits (117), Expect = 3e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 264 GEGMEEGEFSEAREDLAALEKDY 196 GEGMEEGEFSEAREDLAALEKDY Sbjct: 13 GEGMEEGEFSEAREDLAALEKDY 35 >CBY35662.1 unnamed protein product [Oikopleura dioica] Length = 54 Score = 49.7 bits (117), Expect = 3e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 264 GEGMEEGEFSEAREDLAALEKDY 196 GEGMEEGEFSEAREDLAALEKDY Sbjct: 13 GEGMEEGEFSEAREDLAALEKDY 35 >AAK49527.1 alpha-tubulin, partial [Pinus taeda] Length = 54 Score = 49.7 bits (117), Expect = 3e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 264 GEGMEEGEFSEAREDLAALEKDY 196 GEGMEEGEFSEAREDLAALEKDY Sbjct: 13 GEGMEEGEFSEAREDLAALEKDY 35 >ABS72026.1 putative alpha-tubulin, partial [Olea europaea] Length = 63 Score = 49.7 bits (117), Expect = 3e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 264 GEGMEEGEFSEAREDLAALEKDY 196 GEGMEEGEFSEAREDLAALEKDY Sbjct: 23 GEGMEEGEFSEAREDLAALEKDY 45 >EJK73857.1 hypothetical protein THAOC_04498, partial [Thalassiosira oceanica] Length = 67 Score = 49.7 bits (117), Expect = 4e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 264 GEGMEEGEFSEAREDLAALEKDY 196 GEGMEEGEFSEAREDLAALEKDY Sbjct: 34 GEGMEEGEFSEAREDLAALEKDY 56 >KXJ20904.1 Tubulin alpha-3 chain [Exaiptasia pallida] Length = 68 Score = 49.7 bits (117), Expect = 4e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 264 GEGMEEGEFSEAREDLAALEKDY 196 GEGMEEGEFSEAREDLAALEKDY Sbjct: 27 GEGMEEGEFSEAREDLAALEKDY 49 >ELU10530.1 hypothetical protein CAPTEDRAFT_110222, partial [Capitella teleta] Length = 72 Score = 49.7 bits (117), Expect = 4e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 264 GEGMEEGEFSEAREDLAALEKDY 196 GEGMEEGEFSEAREDLAALEKDY Sbjct: 31 GEGMEEGEFSEAREDLAALEKDY 53 >ETE58761.1 Tubulin alpha-8 chain [Ophiophagus hannah] Length = 73 Score = 49.7 bits (117), Expect = 4e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 264 GEGMEEGEFSEAREDLAALEKDY 196 GEGMEEGEFSEAREDLAALEKDY Sbjct: 34 GEGMEEGEFSEAREDLAALEKDY 56 >XP_019781823.1 PREDICTED: tubulin alpha chain [Tursiops truncatus] Length = 74 Score = 49.7 bits (117), Expect = 4e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 264 GEGMEEGEFSEAREDLAALEKDY 196 GEGMEEGEFSEAREDLAALEKDY Sbjct: 34 GEGMEEGEFSEAREDLAALEKDY 56 >XP_017299989.1 PREDICTED: tubulin alpha chain [Diaphorina citri] APA33981.1 seminal fluid protein [Nilaparvata lugens] Length = 74 Score = 49.7 bits (117), Expect = 4e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 264 GEGMEEGEFSEAREDLAALEKDY 196 GEGMEEGEFSEAREDLAALEKDY Sbjct: 34 GEGMEEGEFSEAREDLAALEKDY 56