BLASTX nr result
ID: Lithospermum23_contig00034358
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00034358 (294 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019179328.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 1e-11 XP_011092222.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 1e-11 XP_016538882.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 7e-11 CDP17755.1 unnamed protein product [Coffea canephora] 67 7e-11 XP_015056600.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 3e-10 XP_006358504.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 5e-10 XP_004230378.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 7e-10 XP_019254112.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 9e-10 XP_016473875.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 1e-09 XP_009779232.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 1e-09 XP_016460558.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 2e-09 XP_009603518.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 2e-09 XP_002278276.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 3e-08 CAN77580.1 hypothetical protein VITISV_015346 [Vitis vinifera] 59 3e-08 XP_008366832.2 PREDICTED: pentatricopeptide repeat-containing pr... 56 4e-07 XP_010037982.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 7e-07 AFK39049.1 unknown [Lotus japonicus] 53 8e-07 XP_004495833.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 1e-06 XP_019427578.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 1e-06 XP_009337852.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 1e-06 >XP_019179328.1 PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Ipomoea nil] XP_019179329.1 PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Ipomoea nil] XP_019179330.1 PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Ipomoea nil] Length = 316 Score = 68.9 bits (167), Expect = 1e-11 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = -1 Query: 291 EEEGVEVLEMVKSKGVVPEEDMVREILKGKRGKVYRDIMSILYGK 157 EEEG E++EMVK KG+VPEE V+E+LK KRG VYR +MSILYGK Sbjct: 272 EEEGRELVEMVKKKGIVPEEGKVKEVLKNKRGPVYRTLMSILYGK 316 >XP_011092222.1 PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Sesamum indicum] Length = 306 Score = 68.6 bits (166), Expect = 1e-11 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = -1 Query: 291 EEEGVEVLEMVKSKGVVPEEDMVREILKGKRGKVYRDIMSILYGK 157 E+EG E+LEM+K KGVVPEE VRE+LK KRG VYR +M++LYGK Sbjct: 262 EDEGKEMLEMLKEKGVVPEESKVREVLKSKRGPVYRAVMNVLYGK 306 >XP_016538882.1 PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Capsicum annuum] Length = 315 Score = 66.6 bits (161), Expect = 7e-11 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -1 Query: 291 EEEGVEVLEMVKSKGVVPEEDMVREILKGKRGKVYRDIMSILYGK 157 EEEG E+LE+VKSKG VPEE +RE+LK KRG VYR IM + YGK Sbjct: 271 EEEGQELLEIVKSKGAVPEESKMREVLKSKRGLVYRTIMQVFYGK 315 >CDP17755.1 unnamed protein product [Coffea canephora] Length = 330 Score = 66.6 bits (161), Expect = 7e-11 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = -1 Query: 291 EEEGVEVLEMVKSKGVVPEEDMVREILKGKRGKVYRDIMSILYGK 157 EEEG EVLEM+KSKG+VPEE+ VR+ LK KRG +R +M++LYGK Sbjct: 286 EEEGKEVLEMLKSKGLVPEEEKVRDALKNKRGPAFRTVMNVLYGK 330 >XP_015056600.1 PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Solanum pennellii] Length = 323 Score = 65.1 bits (157), Expect = 3e-10 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = -1 Query: 291 EEEGVEVLEMVKSKGVVPEEDMVREILKGKRGKVYRDIMSILYGK 157 EEEG E+LE VKSKG VPEE +RE+LK KRG VYR IM + YGK Sbjct: 279 EEEGKELLETVKSKGAVPEERKMREVLKNKRGLVYRTIMQVFYGK 323 >XP_006358504.1 PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Solanum tuberosum] Length = 322 Score = 64.3 bits (155), Expect = 5e-10 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = -1 Query: 291 EEEGVEVLEMVKSKGVVPEEDMVREILKGKRGKVYRDIMSILYGK 157 EEEG E+LE+VKSKG VPEE +R++L+ KRG VYR IM + YGK Sbjct: 278 EEEGKELLEIVKSKGAVPEESKMRDVLRNKRGLVYRTIMQVFYGK 322 >XP_004230378.1 PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Solanum lycopersicum] Length = 323 Score = 63.9 bits (154), Expect = 7e-10 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = -1 Query: 291 EEEGVEVLEMVKSKGVVPEEDMVREILKGKRGKVYRDIMSILYGK 157 EEEG E+LE+VKSKG VPEE +RE+LK KRG VYR IM + Y K Sbjct: 279 EEEGKELLEIVKSKGAVPEESKMREVLKNKRGLVYRTIMQVFYDK 323 >XP_019254112.1 PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Nicotiana attenuata] OIS97412.1 pentatricopeptide repeat-containing protein [Nicotiana attenuata] Length = 323 Score = 63.5 bits (153), Expect = 9e-10 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = -1 Query: 291 EEEGVEVLEMVKSKGVVPEEDMVREILKGKRGKVYRDIMSILYGK 157 EEEG E+LE++KSKG VPEE +RE+LK KRG ++R IM + YGK Sbjct: 279 EEEGKELLEIMKSKGAVPEESKMREVLKNKRGPIHRTIMQVFYGK 323 >XP_016473875.1 PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Nicotiana tabacum] Length = 323 Score = 63.2 bits (152), Expect = 1e-09 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = -1 Query: 291 EEEGVEVLEMVKSKGVVPEEDMVREILKGKRGKVYRDIMSILYGK 157 EEEG E+LE++KSKG VPEE +RE+LK KRG ++R IM + YGK Sbjct: 279 EEEGNELLEIMKSKGAVPEESKMREVLKNKRGPIHRTIMQVFYGK 323 >XP_009779232.1 PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Nicotiana sylvestris] Length = 323 Score = 63.2 bits (152), Expect = 1e-09 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = -1 Query: 291 EEEGVEVLEMVKSKGVVPEEDMVREILKGKRGKVYRDIMSILYGK 157 EEEG E+LE++KSKG VPEE +RE+LK KRG ++R IM + YGK Sbjct: 279 EEEGNELLEIMKSKGAVPEESKMREVLKNKRGPIHRTIMQVFYGK 323 >XP_016460558.1 PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Nicotiana tabacum] Length = 319 Score = 62.8 bits (151), Expect = 2e-09 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = -1 Query: 291 EEEGVEVLEMVKSKGVVPEEDMVREILKGKRGKVYRDIMSILYGK 157 EEEG E+LE+VKSKG VPEE +RE+LK KRG ++R IM + YGK Sbjct: 275 EEEGKELLEIVKSKGAVPEEIKMREVLKNKRGPLHRTIMQVFYGK 319 >XP_009603518.1 PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Nicotiana tomentosiformis] Length = 319 Score = 62.8 bits (151), Expect = 2e-09 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = -1 Query: 291 EEEGVEVLEMVKSKGVVPEEDMVREILKGKRGKVYRDIMSILYGK 157 EEEG E+LE+VKSKG VPEE +RE+LK KRG ++R IM + YGK Sbjct: 275 EEEGKELLEIVKSKGAVPEEIKMREVLKNKRGPLHRTIMQVFYGK 319 >XP_002278276.1 PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Vitis vinifera] Length = 307 Score = 59.3 bits (142), Expect = 3e-08 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = -1 Query: 294 KEEEGVEVLEMVKSKGVVPEEDMVREILKGKRGKVYRDIMSILYGK 157 K EEG E LE +K+KG P+E VREILK +RG+V+R IM IL+GK Sbjct: 262 KVEEGREFLEQMKAKGFTPDEKAVREILKNRRGQVFRSIMDILFGK 307 >CAN77580.1 hypothetical protein VITISV_015346 [Vitis vinifera] Length = 347 Score = 59.3 bits (142), Expect = 3e-08 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = -1 Query: 294 KEEEGVEVLEMVKSKGVVPEEDMVREILKGKRGKVYRDIMSILYGK 157 K EEG E LE +K+KG P+E VREILK +RG+V+R IM IL+GK Sbjct: 302 KVEEGREFLEQMKAKGFTPDEKAVREILKNRRGQVFRSIMDILFGK 347 >XP_008366832.2 PREDICTED: pentatricopeptide repeat-containing protein At1g62680, mitochondrial-like [Malus domestica] Length = 370 Score = 56.2 bits (134), Expect = 4e-07 Identities = 26/46 (56%), Positives = 35/46 (76%) Frame = -1 Query: 294 KEEEGVEVLEMVKSKGVVPEEDMVREILKGKRGKVYRDIMSILYGK 157 K EEG E+LE +K KG +PEE V+E+LK KRG V R +++IL+GK Sbjct: 325 KAEEGRELLEEMKGKGFMPEETAVKEVLKSKRGPVVRTVINILFGK 370 >XP_010037982.1 PREDICTED: pentatricopeptide repeat-containing protein At4g38150 [Eucalyptus grandis] KCW84523.1 hypothetical protein EUGRSUZ_B01359 [Eucalyptus grandis] Length = 321 Score = 55.5 bits (132), Expect = 7e-07 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = -1 Query: 294 KEEEGVEVLEMVKSKGVVPEEDMVREILKGKRGKVYRDIMSILYGK 157 KEEE E LE +K +G VP+E VRE + KRG V+R +MSIL+GK Sbjct: 276 KEEEAREFLEAMKGRGFVPDEKAVREAIGSKRGPVFRSVMSILFGK 321 >AFK39049.1 unknown [Lotus japonicus] Length = 108 Score = 52.8 bits (125), Expect = 8e-07 Identities = 23/45 (51%), Positives = 35/45 (77%) Frame = -1 Query: 294 KEEEGVEVLEMVKSKGVVPEEDMVREILKGKRGKVYRDIMSILYG 160 K +E V++LE +K+KG VP+E V E+L KRG V+R++M+IL+G Sbjct: 63 KLDEAVQLLEQMKAKGFVPDEKAVGEVLADKRGSVFRNVMNILFG 107 >XP_004495833.1 PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Cicer arietinum] Length = 283 Score = 54.7 bits (130), Expect = 1e-06 Identities = 23/46 (50%), Positives = 36/46 (78%) Frame = -1 Query: 294 KEEEGVEVLEMVKSKGVVPEEDMVREILKGKRGKVYRDIMSILYGK 157 K +E V++LE +K+KG VP+E VRE+L KRG ++R +++IL+GK Sbjct: 238 KMDEAVQLLEQMKAKGFVPDEKDVREVLSNKRGPIFRTVINILFGK 283 >XP_019427578.1 PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Lupinus angustifolius] OIV91050.1 hypothetical protein TanjilG_17010 [Lupinus angustifolius] Length = 318 Score = 54.7 bits (130), Expect = 1e-06 Identities = 24/46 (52%), Positives = 35/46 (76%) Frame = -1 Query: 294 KEEEGVEVLEMVKSKGVVPEEDMVREILKGKRGKVYRDIMSILYGK 157 K +E E+LE +K+KG VP+E V+E+L KRG V R++M+IL+GK Sbjct: 273 KVDEAAELLEQMKAKGFVPDEKAVKEVLSNKRGPVCRNVMNILFGK 318 >XP_009337852.1 PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Pyrus x bretschneideri] Length = 331 Score = 54.7 bits (130), Expect = 1e-06 Identities = 25/46 (54%), Positives = 34/46 (73%) Frame = -1 Query: 294 KEEEGVEVLEMVKSKGVVPEEDMVREILKGKRGKVYRDIMSILYGK 157 K EEG E+LE +K KG +P+E RE+LK KRG V R +++IL+GK Sbjct: 286 KAEEGRELLEEMKGKGFMPDEKAAREVLKSKRGPVVRTVINILFGK 331