BLASTX nr result
ID: Lithospermum23_contig00033801
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00033801 (255 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP14144.1 unnamed protein product [Coffea canephora] 51 3e-06 >CDP14144.1 unnamed protein product [Coffea canephora] Length = 944 Score = 50.8 bits (120), Expect(2) = 3e-06 Identities = 29/53 (54%), Positives = 34/53 (64%), Gaps = 8/53 (15%) Frame = +1 Query: 1 PPELLRE--------EEHMSYAAMLMPKLIQHIV*VFEAAKWTVGVSIE*FLE 135 PPE+LRE EEHMSYAA+LM L + VFEAAKWTVG + FL+ Sbjct: 496 PPEILREVSAISAPQEEHMSYAAVLMLILTPQLFSVFEAAKWTVGAFLGSFLK 548 Score = 27.3 bits (59), Expect(2) = 3e-06 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +2 Query: 119 LNSFLKCGWPLIYIT 163 L SFLK GWP I+IT Sbjct: 543 LGSFLKGGWPFIHIT 557