BLASTX nr result
ID: Lithospermum23_contig00033355
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00033355 (693 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EPS67910.1 hypothetical protein M569_06867, partial [Genlisea au... 54 1e-06 XP_015068424.1 PREDICTED: vitellogenin-like [Solanum pennellii] 55 4e-06 XP_010327627.1 PREDICTED: vitellogenin-like [Solanum lycopersicum] 55 4e-06 >EPS67910.1 hypothetical protein M569_06867, partial [Genlisea aurea] Length = 62 Score = 54.3 bits (129), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 190 KCAGLDLLVKAIYQVTFGSVIGVPYIQKRV 279 +C GLDLLV+AIYQVT GSVIGVPYIQ+RV Sbjct: 31 RCRGLDLLVRAIYQVTTGSVIGVPYIQRRV 60 >XP_015068424.1 PREDICTED: vitellogenin-like [Solanum pennellii] Length = 167 Score = 55.5 bits (132), Expect = 4e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 190 KCAGLDLLVKAIYQVTFGSVIGVPYIQKRVI 282 +C GLDLLVKAI+QVT GSV+GVPYIQKRVI Sbjct: 58 RCQGLDLLVKAIHQVTDGSVVGVPYIQKRVI 88 >XP_010327627.1 PREDICTED: vitellogenin-like [Solanum lycopersicum] Length = 167 Score = 55.5 bits (132), Expect = 4e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 190 KCAGLDLLVKAIYQVTFGSVIGVPYIQKRVI 282 +C GLDLLVKAI+QVT GSV+GVPYIQKRVI Sbjct: 58 RCQGLDLLVKAIHQVTDGSVVGVPYIQKRVI 88