BLASTX nr result
ID: Lithospermum23_contig00033265
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00033265 (290 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAN93835.1 hypothetical protein, partial [Daphnia magna] 68 1e-12 XP_007389360.1 hypothetical protein PUNSTDRAFT_78207, partial [P... 67 2e-12 XP_006455549.1 hypothetical protein AGABI2DRAFT_75872, partial [... 65 2e-12 XP_007402183.1 hypothetical protein PHACADRAFT_107117, partial [... 65 4e-12 XP_008045701.1 hypothetical protein TRAVEDRAFT_137431, partial [... 65 4e-12 KIM71615.1 hypothetical protein PILCRDRAFT_751960, partial [Pilo... 62 6e-11 KNZ71353.1 Protein TAR1, partial [Termitomyces sp. J132] 60 2e-10 XP_018267507.1 hypothetical protein RHOBADRAFT_19411 [Rhodotorul... 60 2e-10 XP_014072464.1 hypothetical protein COCC4DRAFT_67253 [Bipolaris ... 59 9e-10 XP_001618200.1 hypothetical protein NEMVEDRAFT_v1g155353 [Nemato... 60 1e-09 KXN87604.1 Protein TAR1, partial [Leucoagaricus sp. SymC.cos] 58 2e-09 EMD30456.1 hypothetical protein CERSUDRAFT_61147, partial [Gelat... 57 3e-09 XP_001623984.1 predicted protein [Nematostella vectensis] EDO318... 58 4e-09 XP_001617563.1 hypothetical protein NEMVEDRAFT_v1g49863 [Nematos... 57 5e-09 XP_001618150.1 hypothetical protein NEMVEDRAFT_v1g49420 [Nematos... 57 5e-09 XP_001620069.1 hypothetical protein NEMVEDRAFT_v1g69011 [Nematos... 57 5e-09 XP_001617879.1 hypothetical protein NEMVEDRAFT_v1g156477 [Nemato... 57 6e-09 XP_001633746.1 predicted protein [Nematostella vectensis] EDO416... 57 6e-09 XP_001618307.1 hypothetical protein NEMVEDRAFT_v1g69522 [Nematos... 57 7e-09 XP_001624691.1 predicted protein [Nematostella vectensis] EDO325... 57 7e-09 >JAN93835.1 hypothetical protein, partial [Daphnia magna] Length = 123 Score = 68.2 bits (165), Expect = 1e-12 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +3 Query: 165 RRKAECCKRKSNFNRFPFNNFTYCLTLFPKCFSSFPHGTCSL 290 +RKA+ K + F RFPF+NFTYCLTLF K FSSFPHGTCSL Sbjct: 56 QRKADFPKANTGFKRFPFDNFTYCLTLFSKFFSSFPHGTCSL 97 >XP_007389360.1 hypothetical protein PUNSTDRAFT_78207, partial [Punctularia strigosozonata HHB-11173 SS5] EIN03413.1 hypothetical protein PUNSTDRAFT_78207, partial [Punctularia strigosozonata HHB-11173 SS5] Length = 90 Score = 66.6 bits (161), Expect = 2e-12 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 210 FPFNNFTYCLTLFPKCFSSFPHGTCSL 290 FPFNNFTYCLTLFPKCFSSFPHGTCSL Sbjct: 1 FPFNNFTYCLTLFPKCFSSFPHGTCSL 27 >XP_006455549.1 hypothetical protein AGABI2DRAFT_75872, partial [Agaricus bisporus var. bisporus H97] XP_006458829.1 hypothetical protein AGABI2DRAFT_80166, partial [Agaricus bisporus var. bisporus H97] XP_007335029.1 hypothetical protein AGABI1DRAFT_48203, partial [Agaricus bisporus var. burnettii JB137-S8] EKM74328.1 hypothetical protein AGABI1DRAFT_48203, partial [Agaricus bisporus var. burnettii JB137-S8] EKV41603.1 hypothetical protein AGABI2DRAFT_80166, partial [Agaricus bisporus var. bisporus H97] EKV44288.1 hypothetical protein AGABI2DRAFT_75872, partial [Agaricus bisporus var. bisporus H97] Length = 51 Score = 65.5 bits (158), Expect = 2e-12 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 195 SNFNRFPFNNFTYCLTLFPKCFSSFPHGTCSL 290 ++F RFPF+NFTYCLTLFPK FSSFPHGTCSL Sbjct: 4 TDFKRFPFSNFTYCLTLFPKFFSSFPHGTCSL 35 >XP_007402183.1 hypothetical protein PHACADRAFT_107117, partial [Phanerochaete carnosa HHB-10118-sp] EKM49265.1 hypothetical protein PHACADRAFT_107117, partial [Phanerochaete carnosa HHB-10118-sp] EMD30417.1 hypothetical protein CERSUDRAFT_61185, partial [Gelatoporia subvermispora B] Length = 53 Score = 64.7 bits (156), Expect = 4e-12 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +3 Query: 210 FPFNNFTYCLTLFPKCFSSFPHGTCSL 290 FPF+NFTYCLTLFPKCFSSFPHGTCSL Sbjct: 1 FPFSNFTYCLTLFPKCFSSFPHGTCSL 27 >XP_008045701.1 hypothetical protein TRAVEDRAFT_137431, partial [Trametes versicolor FP-101664 SS1] EIW51414.1 hypothetical protein TRAVEDRAFT_137431, partial [Trametes versicolor FP-101664 SS1] Length = 53 Score = 64.7 bits (156), Expect = 4e-12 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +3 Query: 210 FPFNNFTYCLTLFPKCFSSFPHGTCSL 290 FPF+NFTYCLTLFPKCFSSFPHGTCSL Sbjct: 1 FPFSNFTYCLTLFPKCFSSFPHGTCSL 27 >KIM71615.1 hypothetical protein PILCRDRAFT_751960, partial [Piloderma croceum F 1598] Length = 74 Score = 62.4 bits (150), Expect = 6e-11 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +2 Query: 200 LQSFPFQQFHILFNSLSKVLFIFPSRYLFA 289 LQ+FPFQQFH+LFNSLSKVLFIFPSRYLFA Sbjct: 1 LQTFPFQQFHVLFNSLSKVLFIFPSRYLFA 30 >KNZ71353.1 Protein TAR1, partial [Termitomyces sp. J132] Length = 53 Score = 60.5 bits (145), Expect = 2e-10 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +3 Query: 210 FPFNNFTYCLTLFPKCFSSFPHGTCSL 290 FPF+NFTYCLTLFPK FSSFPHGTCSL Sbjct: 1 FPFSNFTYCLTLFPKFFSSFPHGTCSL 27 >XP_018267507.1 hypothetical protein RHOBADRAFT_19411 [Rhodotorula graminis WP1] KPV71458.1 hypothetical protein RHOBADRAFT_19411 [Rhodotorula graminis WP1] Length = 61 Score = 60.5 bits (145), Expect = 2e-10 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +3 Query: 192 KSNFNRFPFNNFTYCLTLFPKCFSSFPHGTCSL 290 KS+F RFPF F LTLFPKCFSSFPHGTCSL Sbjct: 13 KSDFKRFPFQQFHVLLTLFPKCFSSFPHGTCSL 45 >XP_014072464.1 hypothetical protein COCC4DRAFT_67253 [Bipolaris maydis ATCC 48331] EMD91247.1 hypothetical protein COCHEDRAFT_1156575 [Bipolaris maydis C5] ENH98554.1 hypothetical protein COCC4DRAFT_67253 [Bipolaris maydis ATCC 48331] Length = 70 Score = 59.3 bits (142), Expect = 9e-10 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +3 Query: 192 KSNFNRFPFNNFTYCLTLFPKCFSSFPHGTCSL 290 +S RFPFNNFT CLTLFPKCFSSF H TC+L Sbjct: 5 QSRLVRFPFNNFTCCLTLFPKCFSSFDHSTCAL 37 >XP_001618200.1 hypothetical protein NEMVEDRAFT_v1g155353 [Nematostella vectensis] XP_001619109.1 hypothetical protein NEMVEDRAFT_v1g152336 [Nematostella vectensis] EDO26100.1 predicted protein, partial [Nematostella vectensis] EDO27009.1 predicted protein, partial [Nematostella vectensis] Length = 130 Score = 60.5 bits (145), Expect = 1e-09 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +3 Query: 186 KRKSNFNRFPFNNFTYCLTLFPKCFSSFPHGTCSL 290 +R +N RFPFN FTY LTLF KCFSSFPHGTCSL Sbjct: 9 RRIANPIRFPFNGFTYFLTLFSKCFSSFPHGTCSL 43 >KXN87604.1 Protein TAR1, partial [Leucoagaricus sp. SymC.cos] Length = 51 Score = 57.8 bits (138), Expect = 2e-09 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +3 Query: 195 SNFNRFPFNNFTYCLTLFPKCFSSFPHGTCSL 290 ++F FPF+NF YCLTLFPK FSSFPHGTC L Sbjct: 4 TDFKCFPFSNFMYCLTLFPKFFSSFPHGTCLL 35 >EMD30456.1 hypothetical protein CERSUDRAFT_61147, partial [Gelatoporia subvermispora B] Length = 53 Score = 57.4 bits (137), Expect = 3e-09 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +3 Query: 210 FPFNNFTYCLTLFPKCFSSFPHGTCSL 290 FPF+NFTYCLTLF K FSSFPHGTCSL Sbjct: 1 FPFDNFTYCLTLFSKFFSSFPHGTCSL 27 >XP_001623984.1 predicted protein [Nematostella vectensis] EDO31884.1 predicted protein, partial [Nematostella vectensis] Length = 76 Score = 57.8 bits (138), Expect = 4e-09 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = +3 Query: 207 RFPFNNFTYCLTLFPKCFSSFPHGTCSL 290 RFP+N FTY LTLF KCFSSFPHGTCSL Sbjct: 6 RFPYNGFTYFLTLFSKCFSSFPHGTCSL 33 >XP_001617563.1 hypothetical protein NEMVEDRAFT_v1g49863 [Nematostella vectensis] EDO25463.1 predicted protein, partial [Nematostella vectensis] Length = 52 Score = 57.0 bits (136), Expect = 5e-09 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +3 Query: 210 FPFNNFTYCLTLFPKCFSSFPHGTCSL 290 FPFN FTY LTLF KCFSSFPHGTCSL Sbjct: 1 FPFNGFTYFLTLFSKCFSSFPHGTCSL 27 >XP_001618150.1 hypothetical protein NEMVEDRAFT_v1g49420 [Nematostella vectensis] XP_001619110.1 hypothetical protein NEMVEDRAFT_v1g152347, partial [Nematostella vectensis] XP_001622070.1 hypothetical protein NEMVEDRAFT_v1g142667, partial [Nematostella vectensis] XP_001626312.1 predicted protein, partial [Nematostella vectensis] EDO26050.1 predicted protein, partial [Nematostella vectensis] EDO27010.1 predicted protein, partial [Nematostella vectensis] EDO29970.1 predicted protein, partial [Nematostella vectensis] EDO34212.1 predicted protein, partial [Nematostella vectensis] Length = 54 Score = 57.0 bits (136), Expect = 5e-09 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +3 Query: 210 FPFNNFTYCLTLFPKCFSSFPHGTCSL 290 FPFN FTY LTLF KCFSSFPHGTCSL Sbjct: 1 FPFNGFTYFLTLFSKCFSSFPHGTCSL 27 >XP_001620069.1 hypothetical protein NEMVEDRAFT_v1g69011 [Nematostella vectensis] XP_001626300.1 predicted protein, partial [Nematostella vectensis] XP_001618765.1 hypothetical protein NEMVEDRAFT_v1g153457, partial [Nematostella vectensis] EDO26665.1 predicted protein, partial [Nematostella vectensis] EDO27969.1 predicted protein, partial [Nematostella vectensis] EDO34200.1 predicted protein, partial [Nematostella vectensis] Length = 59 Score = 57.0 bits (136), Expect = 5e-09 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +3 Query: 210 FPFNNFTYCLTLFPKCFSSFPHGTCSL 290 FPFN FTY LTLF KCFSSFPHGTCSL Sbjct: 1 FPFNGFTYFLTLFSKCFSSFPHGTCSL 27 >XP_001617879.1 hypothetical protein NEMVEDRAFT_v1g156477 [Nematostella vectensis] EDO25779.1 predicted protein, partial [Nematostella vectensis] Length = 60 Score = 57.0 bits (136), Expect = 6e-09 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +3 Query: 210 FPFNNFTYCLTLFPKCFSSFPHGTCSL 290 FPFN FTY LTLF KCFSSFPHGTCSL Sbjct: 1 FPFNGFTYFLTLFSKCFSSFPHGTCSL 27 >XP_001633746.1 predicted protein [Nematostella vectensis] EDO41683.1 predicted protein, partial [Nematostella vectensis] Length = 61 Score = 57.0 bits (136), Expect = 6e-09 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +3 Query: 210 FPFNNFTYCLTLFPKCFSSFPHGTCSL 290 FPFN FTY LTLF KCFSSFPHGTCSL Sbjct: 1 FPFNGFTYFLTLFSKCFSSFPHGTCSL 27 >XP_001618307.1 hypothetical protein NEMVEDRAFT_v1g69522 [Nematostella vectensis] EDO26207.1 predicted protein, partial [Nematostella vectensis] Length = 67 Score = 57.0 bits (136), Expect = 7e-09 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +3 Query: 210 FPFNNFTYCLTLFPKCFSSFPHGTCSL 290 FPFN FTY LTLF KCFSSFPHGTCSL Sbjct: 1 FPFNGFTYFLTLFSKCFSSFPHGTCSL 27 >XP_001624691.1 predicted protein [Nematostella vectensis] EDO32591.1 predicted protein, partial [Nematostella vectensis] Length = 70 Score = 57.0 bits (136), Expect = 7e-09 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +3 Query: 210 FPFNNFTYCLTLFPKCFSSFPHGTCSL 290 FPFN FTY LTLF KCFSSFPHGTCSL Sbjct: 1 FPFNGFTYFLTLFSKCFSSFPHGTCSL 27