BLASTX nr result
ID: Lithospermum23_contig00033134
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00033134 (364 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KMT15193.1 hypothetical protein BVRB_3g063040 [Beta vulgaris sub... 54 4e-06 >KMT15193.1 hypothetical protein BVRB_3g063040 [Beta vulgaris subsp. vulgaris] Length = 435 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/53 (43%), Positives = 39/53 (73%) Frame = -1 Query: 205 ADWDRCNGMVIAWLLHSVDRNIAETVLYCDTTAQIARFLGIQFSVARFLGIKV 47 + W+RC+ MVI+WL+HS+ ++IA ++LYCD++A+I L I++ A G K+ Sbjct: 74 SQWERCDNMVISWLIHSMAKDIASSILYCDSSAEIWSELEIRY--AHMSGTKI 124