BLASTX nr result
ID: Lithospermum23_contig00032698
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00032698 (310 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU35532.1 hypothetical protein TSUD_155630 [Trifolium subterran... 64 7e-10 XP_019172321.1 PREDICTED: serine/threonine-protein phosphatase 7... 64 1e-09 XP_010033613.1 PREDICTED: serine/threonine-protein phosphatase 7... 63 2e-09 KHN33196.1 Serine/threonine-protein phosphatase 7 [Glycine soja] 62 3e-09 XP_003548792.1 PREDICTED: serine/threonine-protein phosphatase 7... 62 3e-09 XP_019446916.1 PREDICTED: serine/threonine-protein phosphatase 7... 62 5e-09 XP_009791154.1 PREDICTED: serine/threonine-protein phosphatase 7... 62 5e-09 XP_009603373.1 PREDICTED: serine/threonine-protein phosphatase 7... 62 5e-09 XP_007156268.1 hypothetical protein PHAVU_003G272100g [Phaseolus... 62 5e-09 EYU25688.1 hypothetical protein MIMGU_mgv1a007712mg [Erythranthe... 62 6e-09 KZV58157.1 serine/threonine-protein phosphatase 7 [Dorcoceras hy... 62 6e-09 XP_011098010.1 PREDICTED: serine/threonine-protein phosphatase 7... 62 6e-09 XP_012851445.1 PREDICTED: serine/threonine-protein phosphatase 7... 62 6e-09 XP_010681123.1 PREDICTED: serine/threonine-protein phosphatase 7... 60 2e-08 XP_017604597.1 PREDICTED: serine/threonine-protein phosphatase 7... 60 2e-08 XP_016746296.1 PREDICTED: serine/threonine-protein phosphatase 7... 60 2e-08 XP_016743459.1 PREDICTED: serine/threonine-protein phosphatase 7... 60 2e-08 XP_012487535.1 PREDICTED: serine/threonine-protein phosphatase 7... 60 2e-08 XP_010681122.1 PREDICTED: serine/threonine-protein phosphatase 7... 60 2e-08 XP_017180107.1 PREDICTED: serine/threonine-protein phosphatase 7... 60 2e-08 >GAU35532.1 hypothetical protein TSUD_155630 [Trifolium subterraneum] Length = 445 Score = 64.3 bits (155), Expect = 7e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 310 AVTPRPKANPYYDFEDVIDSDEELDLASMVS 218 AVTPRPKANPYYDFEDV+DSDEELDLASMV+ Sbjct: 414 AVTPRPKANPYYDFEDVLDSDEELDLASMVT 444 >XP_019172321.1 PREDICTED: serine/threonine-protein phosphatase 7 [Ipomoea nil] Length = 468 Score = 63.5 bits (153), Expect = 1e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 310 AVTPRPKANPYYDFEDVIDSDEELDLASMVS 218 AVTPRPKANP+YDFEDVIDSDEELDLASMV+ Sbjct: 437 AVTPRPKANPFYDFEDVIDSDEELDLASMVT 467 >XP_010033613.1 PREDICTED: serine/threonine-protein phosphatase 7 isoform X1 [Eucalyptus grandis] KCW53313.1 hypothetical protein EUGRSUZ_J02567 [Eucalyptus grandis] Length = 472 Score = 62.8 bits (151), Expect = 2e-09 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -1 Query: 310 AVTPRPKANPYYDFEDVIDSDEELDLASMVS 218 AVTPRPKANPYYD++DVIDSDEELDLA+MVS Sbjct: 440 AVTPRPKANPYYDYQDVIDSDEELDLAAMVS 470 >KHN33196.1 Serine/threonine-protein phosphatase 7 [Glycine soja] Length = 451 Score = 62.4 bits (150), Expect = 3e-09 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -1 Query: 310 AVTPRPKANPYYDFEDVIDSDEELDLASMVS 218 AVTPRPKANPYYD+E+VIDSDEELDLASMV+ Sbjct: 420 AVTPRPKANPYYDYEEVIDSDEELDLASMVT 450 >XP_003548792.1 PREDICTED: serine/threonine-protein phosphatase 7-like isoform X1 [Glycine max] KRH07839.1 hypothetical protein GLYMA_16G114700 [Glycine max] Length = 459 Score = 62.4 bits (150), Expect = 3e-09 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -1 Query: 310 AVTPRPKANPYYDFEDVIDSDEELDLASMVS 218 AVTPRPKANPYYD+E+VIDSDEELDLASMV+ Sbjct: 428 AVTPRPKANPYYDYEEVIDSDEELDLASMVT 458 >XP_019446916.1 PREDICTED: serine/threonine-protein phosphatase 7 [Lupinus angustifolius] OIW09610.1 hypothetical protein TanjilG_28209 [Lupinus angustifolius] Length = 454 Score = 62.0 bits (149), Expect = 5e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 310 AVTPRPKANPYYDFEDVIDSDEELDLASMVS 218 AVTPRPK NPYYDFEDVIDSDEELDL SMV+ Sbjct: 423 AVTPRPKVNPYYDFEDVIDSDEELDLTSMVT 453 >XP_009791154.1 PREDICTED: serine/threonine-protein phosphatase 7 [Nicotiana sylvestris] XP_016463599.1 PREDICTED: serine/threonine-protein phosphatase 7-like [Nicotiana tabacum] Length = 457 Score = 62.0 bits (149), Expect = 5e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 310 AVTPRPKANPYYDFEDVIDSDEELDLASMVS 218 AVTPRPK NPYYDFEDVIDSDEELDLASM + Sbjct: 427 AVTPRPKVNPYYDFEDVIDSDEELDLASMAT 457 >XP_009603373.1 PREDICTED: serine/threonine-protein phosphatase 7 [Nicotiana tomentosiformis] XP_016516078.1 PREDICTED: serine/threonine-protein phosphatase 7-like [Nicotiana tabacum] Length = 457 Score = 62.0 bits (149), Expect = 5e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 310 AVTPRPKANPYYDFEDVIDSDEELDLASMVS 218 AVTPRPK NPYYDFEDVIDSDEELDLASM + Sbjct: 427 AVTPRPKVNPYYDFEDVIDSDEELDLASMAT 457 >XP_007156268.1 hypothetical protein PHAVU_003G272100g [Phaseolus vulgaris] ESW28262.1 hypothetical protein PHAVU_003G272100g [Phaseolus vulgaris] Length = 457 Score = 62.0 bits (149), Expect = 5e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 310 AVTPRPKANPYYDFEDVIDSDEELDLASMVS 218 AVTPRPK NPYYDFE+VIDSDEELDLASMV+ Sbjct: 426 AVTPRPKVNPYYDFEEVIDSDEELDLASMVT 456 >EYU25688.1 hypothetical protein MIMGU_mgv1a007712mg [Erythranthe guttata] Length = 398 Score = 61.6 bits (148), Expect = 6e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 310 AVTPRPKANPYYDFEDVIDSDEELDLASMV 221 AVTPRPK NPYYDFEDVIDSDEELDL SMV Sbjct: 359 AVTPRPKVNPYYDFEDVIDSDEELDLVSMV 388 >KZV58157.1 serine/threonine-protein phosphatase 7 [Dorcoceras hygrometricum] Length = 450 Score = 61.6 bits (148), Expect = 6e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 310 AVTPRPKANPYYDFEDVIDSDEELDLASMVS 218 AV PRPK NPYYDFEDVIDSDEELDLASMV+ Sbjct: 418 AVAPRPKVNPYYDFEDVIDSDEELDLASMVA 448 >XP_011098010.1 PREDICTED: serine/threonine-protein phosphatase 7 [Sesamum indicum] Length = 459 Score = 61.6 bits (148), Expect = 6e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 310 AVTPRPKANPYYDFEDVIDSDEELDLASMV 221 AVTPRPK NPYYDFEDVIDSDEELDL SMV Sbjct: 420 AVTPRPKVNPYYDFEDVIDSDEELDLVSMV 449 >XP_012851445.1 PREDICTED: serine/threonine-protein phosphatase 7 [Erythranthe guttata] Length = 464 Score = 61.6 bits (148), Expect = 6e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 310 AVTPRPKANPYYDFEDVIDSDEELDLASMV 221 AVTPRPK NPYYDFEDVIDSDEELDL SMV Sbjct: 425 AVTPRPKVNPYYDFEDVIDSDEELDLVSMV 454 >XP_010681123.1 PREDICTED: serine/threonine-protein phosphatase 7 isoform X2 [Beta vulgaris subsp. vulgaris] KMT08695.1 hypothetical protein BVRB_6g139680 [Beta vulgaris subsp. vulgaris] Length = 429 Score = 60.5 bits (145), Expect = 2e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 310 AVTPRPKANPYYDFEDVIDSDEELDLASMVS 218 AV+PRPKANPYYDFE+VIDSD ELDLASMVS Sbjct: 397 AVSPRPKANPYYDFEEVIDSDGELDLASMVS 427 >XP_017604597.1 PREDICTED: serine/threonine-protein phosphatase 7 [Gossypium arboreum] Length = 447 Score = 60.5 bits (145), Expect = 2e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 310 AVTPRPKANPYYDFEDVIDSDEELDLASMVS 218 A+TPRPK NPYYDFE+VIDSDE+LDLASMV+ Sbjct: 414 AITPRPKVNPYYDFEEVIDSDEDLDLASMVT 444 >XP_016746296.1 PREDICTED: serine/threonine-protein phosphatase 7-like [Gossypium hirsutum] Length = 447 Score = 60.5 bits (145), Expect = 2e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 310 AVTPRPKANPYYDFEDVIDSDEELDLASMVS 218 A+TPRPK NPYYDFE+VIDSDE+LDLASMV+ Sbjct: 414 AITPRPKVNPYYDFEEVIDSDEDLDLASMVT 444 >XP_016743459.1 PREDICTED: serine/threonine-protein phosphatase 7-like [Gossypium hirsutum] Length = 447 Score = 60.5 bits (145), Expect = 2e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 310 AVTPRPKANPYYDFEDVIDSDEELDLASMVS 218 A+TPRPK NPYYDFE+VIDSDE+LDLASMV+ Sbjct: 414 AITPRPKVNPYYDFEEVIDSDEDLDLASMVT 444 >XP_012487535.1 PREDICTED: serine/threonine-protein phosphatase 7 [Gossypium raimondii] KJB10423.1 hypothetical protein B456_001G200300 [Gossypium raimondii] Length = 447 Score = 60.5 bits (145), Expect = 2e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 310 AVTPRPKANPYYDFEDVIDSDEELDLASMVS 218 A+TPRPK NPYYDFE+VIDSDE+LDLASMV+ Sbjct: 414 AITPRPKVNPYYDFEEVIDSDEDLDLASMVT 444 >XP_010681122.1 PREDICTED: serine/threonine-protein phosphatase 7 isoform X1 [Beta vulgaris subsp. vulgaris] Length = 447 Score = 60.5 bits (145), Expect = 2e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 310 AVTPRPKANPYYDFEDVIDSDEELDLASMVS 218 AV+PRPKANPYYDFE+VIDSD ELDLASMVS Sbjct: 415 AVSPRPKANPYYDFEEVIDSDGELDLASMVS 445 >XP_017180107.1 PREDICTED: serine/threonine-protein phosphatase 7-like [Malus domestica] Length = 359 Score = 60.1 bits (144), Expect = 2e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 310 AVTPRPKANPYYDFEDVIDSDEELDLASMVS 218 A+TPRPKANP+YDFE+VIDSDEELDLASM + Sbjct: 327 AITPRPKANPFYDFEEVIDSDEELDLASMAT 357