BLASTX nr result
ID: Lithospermum23_contig00032579
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00032579 (261 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMO95944.1 hypothetical protein CCACVL1_05155 [Corchorus capsula... 89 3e-20 XP_012570190.1 PREDICTED: pentatricopeptide repeat-containing pr... 90 3e-19 XP_019182639.1 PREDICTED: pentatricopeptide repeat-containing pr... 89 5e-19 OMO97875.1 hypothetical protein COLO4_14311 [Corchorus olitorius] 89 1e-18 XP_008234250.1 PREDICTED: pentatricopeptide repeat-containing pr... 87 3e-18 XP_007220061.1 hypothetical protein PRUPE_ppa025794mg [Prunus pe... 87 5e-18 ONI25299.1 hypothetical protein PRUPE_2G294500 [Prunus persica] 87 5e-18 XP_018828301.1 PREDICTED: pentatricopeptide repeat-containing pr... 86 7e-18 XP_019427283.1 PREDICTED: pentatricopeptide repeat-containing pr... 86 9e-18 XP_019427282.1 PREDICTED: pentatricopeptide repeat-containing pr... 86 9e-18 CDP12685.1 unnamed protein product [Coffea canephora] 86 1e-17 XP_010107444.1 hypothetical protein L484_015785 [Morus notabilis... 85 3e-17 XP_014618838.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 4e-17 XP_003535615.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 5e-17 XP_018830691.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 6e-17 XP_018830687.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 6e-17 KRG91518.1 hypothetical protein GLYMA_20G158600 [Glycine max] 83 6e-17 XP_014628058.1 PREDICTED: pentatricopeptide repeat-containing pr... 83 8e-17 XP_003556107.1 PREDICTED: pentatricopeptide repeat-containing pr... 83 9e-17 XP_017972973.1 PREDICTED: pentatricopeptide repeat-containing pr... 83 1e-16 >OMO95944.1 hypothetical protein CCACVL1_05155 [Corchorus capsularis] Length = 216 Score = 89.4 bits (220), Expect = 3e-20 Identities = 43/73 (58%), Positives = 56/73 (76%) Frame = -1 Query: 219 DFPRGFSLRQSYFDTVKSDARKIIEILQQDAPGFDAKLALDYLKLRVSGLLVREVLFGIL 40 D+ FS R +F++ + DA+KI+EILQQD PGFDAK AL L++RVSG LVREVL GIL Sbjct: 26 DYESRFSTRHGFFESGRDDAKKILEILQQDGPGFDAKAALSELQMRVSGFLVREVLVGIL 85 Query: 39 KKFNFADKSRWAK 1 K N+A+++R AK Sbjct: 86 KNINYANRTRCAK 98 >XP_012570190.1 PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like [Cicer arietinum] XP_012570191.1 PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like [Cicer arietinum] Length = 479 Score = 90.1 bits (222), Expect = 3e-19 Identities = 43/68 (63%), Positives = 55/68 (80%) Frame = -1 Query: 204 FSLRQSYFDTVKSDARKIIEILQQDAPGFDAKLALDYLKLRVSGLLVREVLFGILKKFNF 25 FSLRQ + DTVK DA++++EIL+QD PGFDA+L LD L++R SG+LVREVL GILK N Sbjct: 69 FSLRQGFIDTVKVDAKRVLEILRQDGPGFDARLVLDELRIRPSGILVREVLLGILKNINS 128 Query: 24 ADKSRWAK 1 +K+R AK Sbjct: 129 ENKTRCAK 136 >XP_019182639.1 PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like [Ipomoea nil] XP_019182640.1 PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like [Ipomoea nil] XP_019182641.1 PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like [Ipomoea nil] XP_019182642.1 PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like [Ipomoea nil] XP_019182643.1 PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like [Ipomoea nil] Length = 449 Score = 89.4 bits (220), Expect = 5e-19 Identities = 44/68 (64%), Positives = 54/68 (79%) Frame = -1 Query: 204 FSLRQSYFDTVKSDARKIIEILQQDAPGFDAKLALDYLKLRVSGLLVREVLFGILKKFNF 25 FS R ++ + KSDAR+I+E+L QD PGFD K ALD L++R+SGLLVREVL GILK N+ Sbjct: 38 FSTRSNFINDAKSDARQILEVLYQDGPGFDTKTALDDLQVRLSGLLVREVLVGILKTLNY 97 Query: 24 ADKSRWAK 1 ADKSR AK Sbjct: 98 ADKSRCAK 105 >OMO97875.1 hypothetical protein COLO4_14311 [Corchorus olitorius] Length = 459 Score = 88.6 bits (218), Expect = 1e-18 Identities = 42/73 (57%), Positives = 56/73 (76%) Frame = -1 Query: 219 DFPRGFSLRQSYFDTVKSDARKIIEILQQDAPGFDAKLALDYLKLRVSGLLVREVLFGIL 40 D+ FS R +F++ + DA+KI+EILQQD PGFDAK AL +++RVSG LVREVL GIL Sbjct: 43 DYESRFSTRHGFFESGRDDAKKILEILQQDGPGFDAKAALSEMQMRVSGFLVREVLVGIL 102 Query: 39 KKFNFADKSRWAK 1 K N+A+++R AK Sbjct: 103 KNINYANRTRCAK 115 >XP_008234250.1 PREDICTED: pentatricopeptide repeat-containing protein At3g60050-like [Prunus mume] Length = 487 Score = 87.4 bits (215), Expect = 3e-18 Identities = 42/68 (61%), Positives = 52/68 (76%) Frame = -1 Query: 204 FSLRQSYFDTVKSDARKIIEILQQDAPGFDAKLALDYLKLRVSGLLVREVLFGILKKFNF 25 FSLR+S+F+ K R+++E+LQQD PGFD K ALD L + VSGLLVREVLF ILK+ N+ Sbjct: 76 FSLRRSFFENAKIHTRRVLEVLQQDGPGFDTKAALDELHIEVSGLLVREVLFNILKQVNY 135 Query: 24 ADKSRWAK 1 A K R AK Sbjct: 136 ASKMRCAK 143 >XP_007220061.1 hypothetical protein PRUPE_ppa025794mg [Prunus persica] Length = 446 Score = 86.7 bits (213), Expect = 5e-18 Identities = 42/68 (61%), Positives = 52/68 (76%) Frame = -1 Query: 204 FSLRQSYFDTVKSDARKIIEILQQDAPGFDAKLALDYLKLRVSGLLVREVLFGILKKFNF 25 FSLR+S+F+ K R+++E+LQQD PGFD K ALD L + VSGLLVREVLF ILK+ N+ Sbjct: 35 FSLRRSFFENAKIHTRRVLEVLQQDGPGFDTKAALDELHIEVSGLLVREVLFKILKQVNY 94 Query: 24 ADKSRWAK 1 A K R AK Sbjct: 95 ASKMRCAK 102 >ONI25299.1 hypothetical protein PRUPE_2G294500 [Prunus persica] Length = 487 Score = 86.7 bits (213), Expect = 5e-18 Identities = 42/68 (61%), Positives = 52/68 (76%) Frame = -1 Query: 204 FSLRQSYFDTVKSDARKIIEILQQDAPGFDAKLALDYLKLRVSGLLVREVLFGILKKFNF 25 FSLR+S+F+ K R+++E+LQQD PGFD K ALD L + VSGLLVREVLF ILK+ N+ Sbjct: 76 FSLRRSFFENAKIHTRRVLEVLQQDGPGFDTKAALDELHIEVSGLLVREVLFKILKQVNY 135 Query: 24 ADKSRWAK 1 A K R AK Sbjct: 136 ASKMRCAK 143 >XP_018828301.1 PREDICTED: pentatricopeptide repeat-containing protein At3g60050-like [Juglans regia] Length = 486 Score = 86.3 bits (212), Expect = 7e-18 Identities = 42/70 (60%), Positives = 54/70 (77%) Frame = -1 Query: 210 RGFSLRQSYFDTVKSDARKIIEILQQDAPGFDAKLALDYLKLRVSGLLVREVLFGILKKF 31 R S RQ +F VK DAR+++E+L+QD PGFD KLAL+ L +R+SGLLVREVL GIL+ Sbjct: 73 RHLSARQGFFYNVKIDARRVLEVLEQDGPGFDTKLALNELSIRLSGLLVREVLLGILRNV 132 Query: 30 NFADKSRWAK 1 N+A+K R AK Sbjct: 133 NYANKLRSAK 142 >XP_019427283.1 PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like isoform X2 [Lupinus angustifolius] Length = 469 Score = 85.9 bits (211), Expect = 9e-18 Identities = 42/68 (61%), Positives = 54/68 (79%) Frame = -1 Query: 204 FSLRQSYFDTVKSDARKIIEILQQDAPGFDAKLALDYLKLRVSGLLVREVLFGILKKFNF 25 +SLR+ + DTVK DA+K++EIL+QD PG DA+ ALD L +R SG+LVREVLFGILK N Sbjct: 67 YSLRKGFLDTVKLDAKKVLEILRQDGPGLDARSALDELHVRPSGILVREVLFGILKSING 126 Query: 24 ADKSRWAK 1 +K+R AK Sbjct: 127 ENKTRCAK 134 >XP_019427282.1 PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like isoform X1 [Lupinus angustifolius] Length = 477 Score = 85.9 bits (211), Expect = 9e-18 Identities = 42/68 (61%), Positives = 54/68 (79%) Frame = -1 Query: 204 FSLRQSYFDTVKSDARKIIEILQQDAPGFDAKLALDYLKLRVSGLLVREVLFGILKKFNF 25 +SLR+ + DTVK DA+K++EIL+QD PG DA+ ALD L +R SG+LVREVLFGILK N Sbjct: 75 YSLRKGFLDTVKLDAKKVLEILRQDGPGLDARSALDELHVRPSGILVREVLFGILKSING 134 Query: 24 ADKSRWAK 1 +K+R AK Sbjct: 135 ENKTRCAK 142 >CDP12685.1 unnamed protein product [Coffea canephora] Length = 507 Score = 85.9 bits (211), Expect = 1e-17 Identities = 42/67 (62%), Positives = 53/67 (79%) Frame = -1 Query: 201 SLRQSYFDTVKSDARKIIEILQQDAPGFDAKLALDYLKLRVSGLLVREVLFGILKKFNFA 22 S R S+ DTV++DA +++EIL+QD PGFD K ALD LKLR+SGLLVR+VL GIL +FA Sbjct: 97 SSRSSFIDTVRNDANRVLEILRQDGPGFDTKAALDDLKLRLSGLLVRQVLLGILTSISFA 156 Query: 21 DKSRWAK 1 +K R AK Sbjct: 157 NKKRSAK 163 >XP_010107444.1 hypothetical protein L484_015785 [Morus notabilis] EXC15982.1 hypothetical protein L484_015785 [Morus notabilis] Length = 498 Score = 84.7 bits (208), Expect = 3e-17 Identities = 41/68 (60%), Positives = 53/68 (77%) Frame = -1 Query: 204 FSLRQSYFDTVKSDARKIIEILQQDAPGFDAKLALDYLKLRVSGLLVREVLFGILKKFNF 25 FS+RQS+F+T + DA +++E+LQQD PGFDAK ALD L +RVSGLLVR+VL GIL + Sbjct: 87 FSVRQSFFETARIDAGRVLEVLQQDGPGFDAKPALDELNIRVSGLLVRKVLLGILSNISH 146 Query: 24 ADKSRWAK 1 +K R AK Sbjct: 147 TNKIRCAK 154 >XP_014618838.1 PREDICTED: pentatricopeptide repeat-containing protein At3g60050-like isoform X2 [Glycine max] KRH35313.1 hypothetical protein GLYMA_10G235900 [Glycine max] KRH35314.1 hypothetical protein GLYMA_10G235900 [Glycine max] KRH35315.1 hypothetical protein GLYMA_10G235900 [Glycine max] KRH35316.1 hypothetical protein GLYMA_10G235900 [Glycine max] Length = 445 Score = 84.0 bits (206), Expect = 4e-17 Identities = 40/68 (58%), Positives = 54/68 (79%) Frame = -1 Query: 204 FSLRQSYFDTVKSDARKIIEILQQDAPGFDAKLALDYLKLRVSGLLVREVLFGILKKFNF 25 FSLR+ + +TVK DA++++E+L+QD PG DA+L L L +R+SGLLVREVLFGILK N Sbjct: 70 FSLRKGFLETVKLDAKRVLEVLRQDGPGLDARLVLGELHVRLSGLLVREVLFGILKHINC 129 Query: 24 ADKSRWAK 1 +K+R AK Sbjct: 130 ENKTRCAK 137 >XP_003535615.1 PREDICTED: pentatricopeptide repeat-containing protein At3g60050-like isoform X1 [Glycine max] XP_006589544.1 PREDICTED: pentatricopeptide repeat-containing protein At3g60050-like isoform X1 [Glycine max] XP_006589545.1 PREDICTED: pentatricopeptide repeat-containing protein At3g60050-like isoform X1 [Glycine max] KRH35317.1 hypothetical protein GLYMA_10G235900 [Glycine max] Length = 480 Score = 84.0 bits (206), Expect = 5e-17 Identities = 40/68 (58%), Positives = 54/68 (79%) Frame = -1 Query: 204 FSLRQSYFDTVKSDARKIIEILQQDAPGFDAKLALDYLKLRVSGLLVREVLFGILKKFNF 25 FSLR+ + +TVK DA++++E+L+QD PG DA+L L L +R+SGLLVREVLFGILK N Sbjct: 70 FSLRKGFLETVKLDAKRVLEVLRQDGPGLDARLVLGELHVRLSGLLVREVLFGILKHINC 129 Query: 24 ADKSRWAK 1 +K+R AK Sbjct: 130 ENKTRCAK 137 >XP_018830691.1 PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like isoform X2 [Juglans regia] Length = 434 Score = 83.6 bits (205), Expect = 6e-17 Identities = 41/68 (60%), Positives = 53/68 (77%) Frame = -1 Query: 204 FSLRQSYFDTVKSDARKIIEILQQDAPGFDAKLALDYLKLRVSGLLVREVLFGILKKFNF 25 FS R+ +FD VK DAR+ +++L+QD PGFD KLALD L +R+SGLLVREVL GIL+ N Sbjct: 76 FSARRVFFDNVKIDARRGLDVLEQDGPGFDTKLALDELYIRLSGLLVREVLLGILRNVNH 135 Query: 24 ADKSRWAK 1 ++K R AK Sbjct: 136 SNKLRCAK 143 >XP_018830687.1 PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like isoform X1 [Juglans regia] XP_018830688.1 PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like isoform X1 [Juglans regia] XP_018830690.1 PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like isoform X1 [Juglans regia] Length = 487 Score = 83.6 bits (205), Expect = 6e-17 Identities = 41/68 (60%), Positives = 53/68 (77%) Frame = -1 Query: 204 FSLRQSYFDTVKSDARKIIEILQQDAPGFDAKLALDYLKLRVSGLLVREVLFGILKKFNF 25 FS R+ +FD VK DAR+ +++L+QD PGFD KLALD L +R+SGLLVREVL GIL+ N Sbjct: 76 FSARRVFFDNVKIDARRGLDVLEQDGPGFDTKLALDELYIRLSGLLVREVLLGILRNVNH 135 Query: 24 ADKSRWAK 1 ++K R AK Sbjct: 136 SNKLRCAK 143 >KRG91518.1 hypothetical protein GLYMA_20G158600 [Glycine max] Length = 390 Score = 83.2 bits (204), Expect = 6e-17 Identities = 40/68 (58%), Positives = 53/68 (77%) Frame = -1 Query: 204 FSLRQSYFDTVKSDARKIIEILQQDAPGFDAKLALDYLKLRVSGLLVREVLFGILKKFNF 25 FSLR+ + +TVK DA++++E+L+QD PG DA+L L L +R SGLLVREVLFGILK N Sbjct: 70 FSLRKGFLETVKLDAKRVLEVLRQDGPGLDARLVLGELHVRPSGLLVREVLFGILKNINC 129 Query: 24 ADKSRWAK 1 +K+R AK Sbjct: 130 QNKTRCAK 137 >XP_014628058.1 PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like isoform X2 [Glycine max] Length = 445 Score = 83.2 bits (204), Expect = 8e-17 Identities = 40/68 (58%), Positives = 53/68 (77%) Frame = -1 Query: 204 FSLRQSYFDTVKSDARKIIEILQQDAPGFDAKLALDYLKLRVSGLLVREVLFGILKKFNF 25 FSLR+ + +TVK DA++++E+L+QD PG DA+L L L +R SGLLVREVLFGILK N Sbjct: 70 FSLRKGFLETVKLDAKRVLEVLRQDGPGLDARLVLGELHVRPSGLLVREVLFGILKNINC 129 Query: 24 ADKSRWAK 1 +K+R AK Sbjct: 130 QNKTRCAK 137 >XP_003556107.1 PREDICTED: pentatricopeptide repeat-containing protein At3g60050-like isoform X1 [Glycine max] XP_014628056.1 PREDICTED: pentatricopeptide repeat-containing protein At3g60050-like isoform X1 [Glycine max] XP_014628057.1 PREDICTED: pentatricopeptide repeat-containing protein At3g60050-like isoform X1 [Glycine max] KRG91516.1 hypothetical protein GLYMA_20G158600 [Glycine max] KRG91517.1 hypothetical protein GLYMA_20G158600 [Glycine max] Length = 480 Score = 83.2 bits (204), Expect = 9e-17 Identities = 40/68 (58%), Positives = 53/68 (77%) Frame = -1 Query: 204 FSLRQSYFDTVKSDARKIIEILQQDAPGFDAKLALDYLKLRVSGLLVREVLFGILKKFNF 25 FSLR+ + +TVK DA++++E+L+QD PG DA+L L L +R SGLLVREVLFGILK N Sbjct: 70 FSLRKGFLETVKLDAKRVLEVLRQDGPGLDARLVLGELHVRPSGLLVREVLFGILKNINC 129 Query: 24 ADKSRWAK 1 +K+R AK Sbjct: 130 QNKTRCAK 137 >XP_017972973.1 PREDICTED: pentatricopeptide repeat-containing protein At3g60050 [Theobroma cacao] XP_017972974.1 PREDICTED: pentatricopeptide repeat-containing protein At3g60050 [Theobroma cacao] XP_017972975.1 PREDICTED: pentatricopeptide repeat-containing protein At3g60050 [Theobroma cacao] XP_007038689.2 PREDICTED: pentatricopeptide repeat-containing protein At3g60050 [Theobroma cacao] XP_017972976.1 PREDICTED: pentatricopeptide repeat-containing protein At3g60050 [Theobroma cacao] XP_017972977.1 PREDICTED: pentatricopeptide repeat-containing protein At3g60050 [Theobroma cacao] XP_017972978.1 PREDICTED: pentatricopeptide repeat-containing protein At3g60050 [Theobroma cacao] XP_017972979.1 PREDICTED: pentatricopeptide repeat-containing protein At3g60050 [Theobroma cacao] XP_017972980.1 PREDICTED: pentatricopeptide repeat-containing protein At3g60050 [Theobroma cacao] Length = 488 Score = 82.8 bits (203), Expect = 1e-16 Identities = 39/65 (60%), Positives = 51/65 (78%) Frame = -1 Query: 195 RQSYFDTVKSDARKIIEILQQDAPGFDAKLALDYLKLRVSGLLVREVLFGILKKFNFADK 16 R +F + + DAR+I+E+LQQD PGFDAK AL +++RVSG LVREVL GILK N+A+K Sbjct: 80 RHGFFKSGRDDARRILEVLQQDGPGFDAKAALSEMQMRVSGFLVREVLVGILKNINYANK 139 Query: 15 SRWAK 1 +R AK Sbjct: 140 TRCAK 144