BLASTX nr result
ID: Lithospermum23_contig00032552
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00032552 (250 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011082761.1 PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTY... 51 7e-06 >XP_011082761.1 PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Sesamum indicum] Length = 182 Score = 51.2 bits (121), Expect = 7e-06 Identities = 28/48 (58%), Positives = 33/48 (68%), Gaps = 3/48 (6%) Frame = +1 Query: 115 MREQLGEGILKSPSSSIAKPTTNN---QQQPIQLSRYESQKRRDWNTF 249 M G G ++ SSS +KP + + QQQP QLSRYESQKRRDWNTF Sbjct: 2 MSNDPGGGGGEAGSSSSSKPASASAADQQQPAQLSRYESQKRRDWNTF 49