BLASTX nr result
ID: Lithospermum23_contig00032183
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00032183 (321 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_002304647.1 hypothetical protein POPTR_0003s16270g [Populus t... 56 4e-07 XP_011020854.1 PREDICTED: uncharacterized protein LOC105123081 [... 55 1e-06 XP_002297870.1 hypothetical protein POPTR_0001s13170g [Populus t... 52 2e-06 XP_002512651.1 PREDICTED: protein NETWORKED 3A [Ricinus communis... 53 6e-06 >XP_002304647.1 hypothetical protein POPTR_0003s16270g [Populus trichocarpa] EEE79626.1 hypothetical protein POPTR_0003s16270g [Populus trichocarpa] Length = 288 Score = 56.2 bits (134), Expect = 4e-07 Identities = 28/53 (52%), Positives = 41/53 (77%), Gaps = 1/53 (1%) Frame = -3 Query: 319 DELELEIPKMVEDSLSPQAELIKRIEEKR-VVKELEMQINELMEENKMLKGTL 164 +EL L++ ++++DSL Q+ELIKR +EKR V+K L QI+ LMEEN++LK L Sbjct: 207 NELRLQVSELIDDSLQQQSELIKRNDEKREVIKHLRAQISRLMEENRVLKSYL 259 >XP_011020854.1 PREDICTED: uncharacterized protein LOC105123081 [Populus euphratica] Length = 288 Score = 55.1 bits (131), Expect = 1e-06 Identities = 28/53 (52%), Positives = 40/53 (75%), Gaps = 1/53 (1%) Frame = -3 Query: 319 DELELEIPKMVEDSLSPQAELIKRIEEKR-VVKELEMQINELMEENKMLKGTL 164 +EL L++ +++DSL Q+ELIKR +EKR V+K L QI+ LMEEN++LK L Sbjct: 207 NELRLQVSGLIDDSLQQQSELIKRNDEKREVIKHLRAQISRLMEENRVLKSYL 259 >XP_002297870.1 hypothetical protein POPTR_0001s13170g [Populus trichocarpa] EEE82675.1 hypothetical protein POPTR_0001s13170g [Populus trichocarpa] Length = 93 Score = 52.0 bits (123), Expect = 2e-06 Identities = 29/54 (53%), Positives = 39/54 (72%), Gaps = 2/54 (3%) Frame = -3 Query: 319 DELELEIPKMVE-DSLSPQAELIKRIEEKR-VVKELEMQINELMEENKMLKGTL 164 D L L++ +++ DSL Q+ELIKR +EKR V+K L QIN LMEEN++LK L Sbjct: 11 DALRLQVSELITGDSLQQQSELIKRNDEKREVIKHLSAQINRLMEENRILKSYL 64 >XP_002512651.1 PREDICTED: protein NETWORKED 3A [Ricinus communis] XP_015570449.1 PREDICTED: protein NETWORKED 3A [Ricinus communis] EEF50103.1 conserved hypothetical protein [Ricinus communis] Length = 229 Score = 52.8 bits (125), Expect = 6e-06 Identities = 30/65 (46%), Positives = 42/65 (64%), Gaps = 1/65 (1%) Frame = -3 Query: 313 LELEIPKMVEDSLSPQAELIKRIEEKR-VVKELEMQINELMEENKMLKGTLQAAHQEHSC 137 L L + K++ED+ QAELI+R +EKR V+K+L QI+ LMEEN+ L G AH + Sbjct: 151 LRLTVSKLIEDNRRQQAELIRRNDEKREVIKQLREQISRLMEENRALMG---CAHVDLKR 207 Query: 136 SCDKN 122 C+ N Sbjct: 208 ICEHN 212