BLASTX nr result
ID: Lithospermum23_contig00032167
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00032167 (380 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP00224.1 unnamed protein product [Coffea canephora] 60 1e-09 KZV36334.1 hypothetical protein F511_25134 [Dorcoceras hygrometr... 60 1e-09 >CDP00224.1 unnamed protein product [Coffea canephora] Length = 83 Score = 60.5 bits (145), Expect = 1e-09 Identities = 37/75 (49%), Positives = 49/75 (65%), Gaps = 14/75 (18%) Frame = +3 Query: 69 ENPF--AGDSKTGES----KRLGGPAPKLTKKMSQKFEKTKVVASAGMKKMKE------- 209 ENP+ A +K +S KRLGGP+PKL++K+S+KFE+TK VASAGMKK+KE Sbjct: 9 ENPWSAANQNKAPKSPRQPKRLGGPSPKLSRKVSEKFERTKEVASAGMKKVKEGASTSVH 68 Query: 210 -XXXXMNKNKLFEKK 251 N+ KL +KK Sbjct: 69 WIKLKYNQTKLAQKK 83 >KZV36334.1 hypothetical protein F511_25134 [Dorcoceras hygrometricum] Length = 89 Score = 60.5 bits (145), Expect = 1e-09 Identities = 33/65 (50%), Positives = 44/65 (67%), Gaps = 4/65 (6%) Frame = +3 Query: 69 ENPFAGDSKTG----ESKRLGGPAPKLTKKMSQKFEKTKVVASAGMKKMKEXXXXMNKNK 236 ENPF G + + E +RLGGP+PKL+K++S+KFE+TK VASAGM+K E K K Sbjct: 6 ENPFGGSTASAKPAAEPRRLGGPSPKLSKRLSEKFERTKEVASAGMEKSVE------KTK 59 Query: 237 LFEKK 251 + KK Sbjct: 60 VAAKK 64