BLASTX nr result
ID: Lithospermum23_contig00032042
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00032042 (437 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value NP_001308203.1 NAC domain-containing protein [Solanum lycopersicum] 80 3e-15 XP_015068220.1 PREDICTED: NAC domain-containing protein 100 [Sol... 80 3e-15 XP_011071688.1 PREDICTED: NAC domain-containing protein 100-like... 79 1e-14 OMP11596.1 No apical meristem (NAM) protein [Corchorus capsularis] 79 1e-14 XP_009625550.1 PREDICTED: NAC domain-containing protein 100-like... 79 2e-14 XP_016466638.1 PREDICTED: NAC domain-containing protein 100-like... 79 2e-14 XP_009767926.1 PREDICTED: NAC domain-containing protein 100-like... 79 2e-14 OMP14076.1 No apical meristem (NAM) protein [Corchorus olitorius] 79 2e-14 XP_011087231.1 PREDICTED: NAC domain-containing protein 100-like... 78 2e-14 XP_006364584.1 PREDICTED: NAC domain-containing protein 100 [Sol... 78 2e-14 ALC78994.1 NAC transcription factors 17 [Manihot esculenta] OAY4... 78 3e-14 XP_002514736.1 PREDICTED: NAC domain-containing protein 100 [Ric... 78 3e-14 XP_012080293.1 PREDICTED: NAC domain-containing protein 100 [Jat... 78 3e-14 AGC27314.1 NAC domain protein 11 [Gossypium hirsutum] 77 4e-14 XP_009802185.1 PREDICTED: NAC domain-containing protein 100 isof... 77 4e-14 XP_015078073.1 PREDICTED: NAC domain-containing protein 92-like ... 77 5e-14 XP_004241586.1 PREDICTED: NAC domain-containing protein 100-like... 77 5e-14 KJB50951.1 hypothetical protein B456_008G194400 [Gossypium raimo... 77 5e-14 XP_017972125.1 PREDICTED: NAC domain-containing protein 100 [The... 77 5e-14 XP_019237431.1 PREDICTED: NAC domain-containing protein 100-like... 77 5e-14 >NP_001308203.1 NAC domain-containing protein [Solanum lycopersicum] Length = 328 Score = 80.5 bits (197), Expect = 3e-15 Identities = 39/51 (76%), Positives = 45/51 (88%), Gaps = 1/51 (1%) Frame = -1 Query: 437 YRLEGKMSLENLPK-VKNDWVISRVFQKSSGGKKVHISGMVRMNSIGNEMV 288 YRLEG++SL NLPK VKNDWVI RVFQK++GGKK+HISG+VR NS NEMV Sbjct: 143 YRLEGRLSLNNLPKTVKNDWVICRVFQKTTGGKKIHISGLVRANSDENEMV 193 >XP_015068220.1 PREDICTED: NAC domain-containing protein 100 [Solanum pennellii] Length = 331 Score = 80.5 bits (197), Expect = 3e-15 Identities = 39/51 (76%), Positives = 45/51 (88%), Gaps = 1/51 (1%) Frame = -1 Query: 437 YRLEGKMSLENLPK-VKNDWVISRVFQKSSGGKKVHISGMVRMNSIGNEMV 288 YRLEG++SL NLPK VKNDWVI RVFQK++GGKK+HISG+VR NS NEMV Sbjct: 142 YRLEGRLSLNNLPKTVKNDWVICRVFQKTTGGKKIHISGLVRANSDENEMV 192 >XP_011071688.1 PREDICTED: NAC domain-containing protein 100-like [Sesamum indicum] XP_011071689.1 PREDICTED: NAC domain-containing protein 100-like [Sesamum indicum] Length = 355 Score = 79.0 bits (193), Expect = 1e-14 Identities = 38/48 (79%), Positives = 43/48 (89%), Gaps = 1/48 (2%) Frame = -1 Query: 437 YRLEGKMSLENLPK-VKNDWVISRVFQKSSGGKKVHISGMVRMNSIGN 297 YR+EGK S+ENLPK +NDWVISRVFQK+SGGKKVHISG+VRMNS N Sbjct: 139 YRMEGKFSIENLPKSARNDWVISRVFQKTSGGKKVHISGLVRMNSEEN 186 >OMP11596.1 No apical meristem (NAM) protein [Corchorus capsularis] Length = 360 Score = 79.0 bits (193), Expect = 1e-14 Identities = 37/50 (74%), Positives = 44/50 (88%), Gaps = 1/50 (2%) Frame = -1 Query: 437 YRLEGKMSLENLPKV-KNDWVISRVFQKSSGGKKVHISGMVRMNSIGNEM 291 YRLEGK S+ NLPK KN+WVI RVFQKSSGGKK+HISG+VR++S GNE+ Sbjct: 139 YRLEGKYSVHNLPKTAKNEWVICRVFQKSSGGKKIHISGLVRVDSFGNEL 188 >XP_009625550.1 PREDICTED: NAC domain-containing protein 100-like [Nicotiana tomentosiformis] XP_016463159.1 PREDICTED: NAC domain-containing protein 100-like [Nicotiana tabacum] Length = 326 Score = 78.6 bits (192), Expect = 2e-14 Identities = 36/50 (72%), Positives = 44/50 (88%), Gaps = 1/50 (2%) Frame = -1 Query: 437 YRLEGKMSLENLPKV-KNDWVISRVFQKSSGGKKVHISGMVRMNSIGNEM 291 YRLEG++SL NLPK KNDWVI RVFQK++GGKK+HISG+++ NS GNEM Sbjct: 141 YRLEGRLSLHNLPKTAKNDWVICRVFQKTTGGKKIHISGLMQSNSTGNEM 190 >XP_016466638.1 PREDICTED: NAC domain-containing protein 100-like [Nicotiana tabacum] Length = 329 Score = 78.6 bits (192), Expect = 2e-14 Identities = 36/50 (72%), Positives = 44/50 (88%), Gaps = 1/50 (2%) Frame = -1 Query: 437 YRLEGKMSLENLPKV-KNDWVISRVFQKSSGGKKVHISGMVRMNSIGNEM 291 YRLEG++SL NLPK KNDWVI RVFQK++GGKK+HISG+++ NS GNEM Sbjct: 144 YRLEGRLSLHNLPKTAKNDWVICRVFQKTTGGKKIHISGLMQSNSTGNEM 193 >XP_009767926.1 PREDICTED: NAC domain-containing protein 100-like [Nicotiana sylvestris] Length = 329 Score = 78.6 bits (192), Expect = 2e-14 Identities = 36/50 (72%), Positives = 44/50 (88%), Gaps = 1/50 (2%) Frame = -1 Query: 437 YRLEGKMSLENLPKV-KNDWVISRVFQKSSGGKKVHISGMVRMNSIGNEM 291 YRLEG++SL NLPK KNDWVI RVFQK++GGKK+HISG+++ NS GNEM Sbjct: 144 YRLEGRLSLHNLPKTAKNDWVICRVFQKTTGGKKIHISGLMQSNSTGNEM 193 >OMP14076.1 No apical meristem (NAM) protein [Corchorus olitorius] Length = 361 Score = 78.6 bits (192), Expect = 2e-14 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 1/50 (2%) Frame = -1 Query: 437 YRLEGKMSLENLPKV-KNDWVISRVFQKSSGGKKVHISGMVRMNSIGNEM 291 YRLEGK S+ NLPK KN+WVI RVFQKSSGGKK+HISG+VR+ S GNE+ Sbjct: 139 YRLEGKYSVHNLPKTAKNEWVICRVFQKSSGGKKIHISGLVRVGSFGNEL 188 >XP_011087231.1 PREDICTED: NAC domain-containing protein 100-like [Sesamum indicum] Length = 329 Score = 78.2 bits (191), Expect = 2e-14 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 1/50 (2%) Frame = -1 Query: 437 YRLEGKMSLENLPK-VKNDWVISRVFQKSSGGKKVHISGMVRMNSIGNEM 291 YRLEGK L+NLPK KNDWVISRVFQK+S G+KVHISG+ RM+S GNEM Sbjct: 139 YRLEGKFHLQNLPKSAKNDWVISRVFQKTSSGQKVHISGLTRMDSQGNEM 188 >XP_006364584.1 PREDICTED: NAC domain-containing protein 100 [Solanum tuberosum] Length = 333 Score = 78.2 bits (191), Expect = 2e-14 Identities = 38/51 (74%), Positives = 45/51 (88%), Gaps = 1/51 (1%) Frame = -1 Query: 437 YRLEGKMSLENLPK-VKNDWVISRVFQKSSGGKKVHISGMVRMNSIGNEMV 288 YRLEG++SL NLPK VKNDWVI RVFQK++GGKK+HISG+VR NS NE+V Sbjct: 144 YRLEGRLSLNNLPKTVKNDWVICRVFQKTTGGKKIHISGLVRGNSDENEIV 194 >ALC78994.1 NAC transcription factors 17 [Manihot esculenta] OAY47596.1 hypothetical protein MANES_06G090500 [Manihot esculenta] OAY47597.1 hypothetical protein MANES_06G090500 [Manihot esculenta] Length = 358 Score = 78.2 bits (191), Expect = 3e-14 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 1/50 (2%) Frame = -1 Query: 437 YRLEGKMSLENLPKV-KNDWVISRVFQKSSGGKKVHISGMVRMNSIGNEM 291 YRLEGK S+ NLPK KN+WVI RVFQKSSGGKK HISG+VR+ S GNE+ Sbjct: 139 YRLEGKFSVHNLPKTAKNEWVICRVFQKSSGGKKTHISGLVRLGSFGNEL 188 >XP_002514736.1 PREDICTED: NAC domain-containing protein 100 [Ricinus communis] EEF47842.1 NAC domain-containing protein 21/22, putative [Ricinus communis] Length = 361 Score = 78.2 bits (191), Expect = 3e-14 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 1/50 (2%) Frame = -1 Query: 437 YRLEGKMSLENLPKV-KNDWVISRVFQKSSGGKKVHISGMVRMNSIGNEM 291 YRLEGK S+ NLPK KN+WVI RVFQKSSGGKK HISG+VR+ S GNE+ Sbjct: 139 YRLEGKYSIHNLPKTAKNEWVICRVFQKSSGGKKTHISGLVRLGSFGNEL 188 >XP_012080293.1 PREDICTED: NAC domain-containing protein 100 [Jatropha curcas] AGL39658.1 NAC transcription factor 002 [Jatropha curcas] KDP31273.1 hypothetical protein JCGZ_11649 [Jatropha curcas] Length = 361 Score = 78.2 bits (191), Expect = 3e-14 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 1/50 (2%) Frame = -1 Query: 437 YRLEGKMSLENLPKV-KNDWVISRVFQKSSGGKKVHISGMVRMNSIGNEM 291 YRLEGK S+ NLPK KN+WVI RVFQKSSGGKK HISG+VR+ S GNE+ Sbjct: 139 YRLEGKFSVHNLPKTAKNEWVICRVFQKSSGGKKTHISGLVRLGSFGNEL 188 >AGC27314.1 NAC domain protein 11 [Gossypium hirsutum] Length = 292 Score = 77.0 bits (188), Expect = 4e-14 Identities = 37/50 (74%), Positives = 41/50 (82%), Gaps = 1/50 (2%) Frame = -1 Query: 437 YRLEGKMSLENLPKV-KNDWVISRVFQKSSGGKKVHISGMVRMNSIGNEM 291 YRLEGK S+ NLPK KN+WVI RVFQKSSGGKK HISG+V M S GNE+ Sbjct: 73 YRLEGKYSVHNLPKTAKNEWVICRVFQKSSGGKKTHISGLVNMGSFGNEL 122 >XP_009802185.1 PREDICTED: NAC domain-containing protein 100 isoform X2 [Nicotiana sylvestris] XP_016439816.1 PREDICTED: NAC domain-containing protein 100-like isoform X2 [Nicotiana tabacum] Length = 294 Score = 77.0 bits (188), Expect = 4e-14 Identities = 36/50 (72%), Positives = 44/50 (88%), Gaps = 1/50 (2%) Frame = -1 Query: 437 YRLEGKMSLENLPKV-KNDWVISRVFQKSSGGKKVHISGMVRMNSIGNEM 291 YRLEG++SL+NLPK KN+WVI RVFQKS GGKK+HISG+V++NS NEM Sbjct: 91 YRLEGRLSLQNLPKTAKNEWVICRVFQKSCGGKKIHISGLVKLNSDENEM 140 >XP_015078073.1 PREDICTED: NAC domain-containing protein 92-like [Solanum pennellii] Length = 338 Score = 77.4 bits (189), Expect = 5e-14 Identities = 36/50 (72%), Positives = 45/50 (90%), Gaps = 1/50 (2%) Frame = -1 Query: 437 YRLEGKMSLENLPKV-KNDWVISRVFQKSSGGKKVHISGMVRMNSIGNEM 291 +RLEGK+SL+NLPK KN+WVI RVFQKSSGGKK+HISG++++NS NEM Sbjct: 139 FRLEGKLSLQNLPKTAKNEWVICRVFQKSSGGKKIHISGLLKLNSNENEM 188 >XP_004241586.1 PREDICTED: NAC domain-containing protein 100-like [Solanum lycopersicum] Length = 339 Score = 77.4 bits (189), Expect = 5e-14 Identities = 36/50 (72%), Positives = 45/50 (90%), Gaps = 1/50 (2%) Frame = -1 Query: 437 YRLEGKMSLENLPKV-KNDWVISRVFQKSSGGKKVHISGMVRMNSIGNEM 291 +RLEGK+SL+NLPK KN+WVI RVFQKSSGGKK+HISG++++NS NEM Sbjct: 139 FRLEGKLSLQNLPKTAKNEWVICRVFQKSSGGKKIHISGLLKLNSNENEM 188 >KJB50951.1 hypothetical protein B456_008G194400 [Gossypium raimondii] Length = 302 Score = 77.0 bits (188), Expect = 5e-14 Identities = 37/50 (74%), Positives = 41/50 (82%), Gaps = 1/50 (2%) Frame = -1 Query: 437 YRLEGKMSLENLPKV-KNDWVISRVFQKSSGGKKVHISGMVRMNSIGNEM 291 YRLEGK S+ NLPK KN+WVI RVFQKSSGGKK HISG+V M S GNE+ Sbjct: 83 YRLEGKYSVHNLPKTAKNEWVICRVFQKSSGGKKTHISGLVNMGSFGNEL 132 >XP_017972125.1 PREDICTED: NAC domain-containing protein 100 [Theobroma cacao] EOY21905.1 NAC domain protein, IPR003441 [Theobroma cacao] Length = 358 Score = 77.4 bits (189), Expect = 5e-14 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 1/50 (2%) Frame = -1 Query: 437 YRLEGKMSLENLPKV-KNDWVISRVFQKSSGGKKVHISGMVRMNSIGNEM 291 YRLEGK S+ NLPK KN+WVI RVFQKSSGGKK HISG+VR+ S GNE+ Sbjct: 139 YRLEGKYSVHNLPKTAKNEWVICRVFQKSSGGKKTHISGLVRVGSFGNEL 188 >XP_019237431.1 PREDICTED: NAC domain-containing protein 100-like [Nicotiana attenuata] OIT22421.1 nac domain-containing protein 100 [Nicotiana attenuata] Length = 321 Score = 77.0 bits (188), Expect = 5e-14 Identities = 36/50 (72%), Positives = 44/50 (88%), Gaps = 1/50 (2%) Frame = -1 Query: 437 YRLEGKMSLENLPKV-KNDWVISRVFQKSSGGKKVHISGMVRMNSIGNEM 291 YRLEG++SL+NLPK KN+WVI RVFQKS GGKK+HISG+V++NS NEM Sbjct: 140 YRLEGRLSLQNLPKTAKNEWVICRVFQKSCGGKKIHISGLVKLNSDENEM 189