BLASTX nr result
ID: Lithospermum23_contig00031929
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00031929 (443 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019252509.1 PREDICTED: putative pentatricopeptide repeat-cont... 50 4e-09 XP_016546537.1 PREDICTED: putative pentatricopeptide repeat-cont... 50 5e-08 XP_016486595.1 PREDICTED: putative pentatricopeptide repeat-cont... 50 1e-07 XP_009595137.1 PREDICTED: putative pentatricopeptide repeat-cont... 51 1e-07 XP_016448794.1 PREDICTED: putative pentatricopeptide repeat-cont... 51 1e-07 XP_009782067.1 PREDICTED: putative pentatricopeptide repeat-cont... 50 2e-07 >XP_019252509.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana attenuata] XP_019252510.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana attenuata] XP_019252511.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana attenuata] OIS99760.1 putative pentatricopeptide repeat-containing protein [Nicotiana attenuata] Length = 807 Score = 50.4 bits (119), Expect(2) = 4e-09 Identities = 23/40 (57%), Positives = 27/40 (67%) Frame = -2 Query: 121 FFAMRNGFGVKHSRSCFFFIAHVLAGMSRARALKFHLMNM 2 FF +RN +G KHSR +AHVLA R RALKFHL N+ Sbjct: 103 FFLLRNDYGFKHSRVSHIVVAHVLAKKQRFRALKFHLQNL 142 Score = 37.7 bits (86), Expect(2) = 4e-09 Identities = 35/109 (32%), Positives = 54/109 (49%), Gaps = 6/109 (5%) Frame = -3 Query: 426 MHRLTPKFPTSLKPHLISPLS-TFTTNLLEATPSPIDHPQNDVVSSILTHLTQPL----- 265 M RL K+P LKP L P S + A +DHP+ ++ T ++ L Sbjct: 1 MLRLILKYP--LKPQL--PYSFLLLKSSFSAAALAVDHPEPPPTTTTRTAFSKILNFFQT 56 Query: 264 MTTKGSLNYSIKTRPLLKNLLTNIDPFQAEEIIISLFRKNQFETVLEFF 118 TKGS +K P +KNL+ +++ + E+I+ L +N E+ LEFF Sbjct: 57 YCTKGSAKL-LKGDPCIKNLIFDLNELEIEDIVEKLSVENS-ESALEFF 103 >XP_016546537.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Capsicum annuum] Length = 808 Score = 50.1 bits (118), Expect(2) = 5e-08 Identities = 21/40 (52%), Positives = 28/40 (70%) Frame = -2 Query: 121 FFAMRNGFGVKHSRSCFFFIAHVLAGMSRARALKFHLMNM 2 FF +RN +G HSR +F +AH+LA R RALKFHL ++ Sbjct: 78 FFLLRNEYGFSHSRVSYFLVAHILAKKQRFRALKFHLQDL 117 Score = 34.3 bits (77), Expect(2) = 5e-08 Identities = 25/75 (33%), Positives = 38/75 (50%), Gaps = 4/75 (5%) Frame = -3 Query: 330 SPIDHPQNDVVSSIL----THLTQPLMTTKGSLNYSIKTRPLLKNLLTNIDPFQAEEIII 163 SP P ++SS++ + T L TKGS+N K P KNL+ ++ + E II Sbjct: 8 SPFKSP---LISSLILLKSSFSTTNLAITKGSIN-PFKANPSFKNLILELNLVEIEGIIE 63 Query: 162 SLFRKNQFETVLEFF 118 L + +E +EFF Sbjct: 64 KLTVLDYYEIAIEFF 78 >XP_016486595.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana tabacum] XP_016486596.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana tabacum] XP_016486597.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana tabacum] XP_016486598.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana tabacum] XP_016486599.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana tabacum] XP_016486600.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana tabacum] XP_016486601.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana tabacum] XP_016486602.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana tabacum] XP_016486603.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana tabacum] XP_016486604.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana tabacum] XP_016486605.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana tabacum] Length = 807 Score = 50.4 bits (119), Expect(2) = 1e-07 Identities = 23/40 (57%), Positives = 27/40 (67%) Frame = -2 Query: 121 FFAMRNGFGVKHSRSCFFFIAHVLAGMSRARALKFHLMNM 2 FF +RN +G KHSR +AHVLA R RALKFHL N+ Sbjct: 103 FFLLRNDYGFKHSRVSHVIVAHVLAKKQRFRALKFHLQNL 142 Score = 32.7 bits (73), Expect(2) = 1e-07 Identities = 34/110 (30%), Positives = 52/110 (47%), Gaps = 7/110 (6%) Frame = -3 Query: 426 MHRLTPKFPTSLKPHLISPLSTFTTNLLEATPSPIDHPQND-------VVSSILTHLTQP 268 M RL K P LKP L + ++ A+ + +DHP+ S+ILT Sbjct: 1 MLRLILKCP--LKPQLPYSILLLKSSFSAASLA-VDHPEPPPTTTTKIAFSNILTFFQT- 56 Query: 267 LMTTKGSLNYSIKTRPLLKNLLTNIDPFQAEEIIISLFRKNQFETVLEFF 118 TKGS +K P KNL+ ++ + E+I+ L +N ++ LEFF Sbjct: 57 -YCTKGSAKL-LKADPCYKNLIFELNELEIEDIVEKLSVENS-DSALEFF 103 >XP_009595137.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana tomentosiformis] XP_009595139.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana tomentosiformis] XP_018624738.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana tomentosiformis] XP_018624739.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana tomentosiformis] XP_018624740.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana tomentosiformis] XP_018624741.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana tomentosiformis] XP_018624742.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana tomentosiformis] XP_018624743.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana tomentosiformis] Length = 808 Score = 50.8 bits (120), Expect(2) = 1e-07 Identities = 23/40 (57%), Positives = 27/40 (67%) Frame = -2 Query: 121 FFAMRNGFGVKHSRSCFFFIAHVLAGMSRARALKFHLMNM 2 FF +RN +G KHSR +AHVLA R RALKFHL N+ Sbjct: 104 FFLLRNDYGFKHSRVSHIIVAHVLAKKQRFRALKFHLQNL 143 Score = 32.0 bits (71), Expect(2) = 1e-07 Identities = 33/110 (30%), Positives = 49/110 (44%), Gaps = 7/110 (6%) Frame = -3 Query: 426 MHRLTPKFPTSLKPHLISPLS-TFTTNLLEATPSPIDHPQNDVVSSILTHLTQPLMT--- 259 M RL K P KP L P S + A +DHP+ ++ ++T Sbjct: 1 MLRLILKCP--FKPQL--PYSFLLLKSSFSAASLAVDHPEPPTTTTTTKTAFSKILTFFQ 56 Query: 258 ---TKGSLNYSIKTRPLLKNLLTNIDPFQAEEIIISLFRKNQFETVLEFF 118 TKGS +K P +KNL+ ++ + E I+ L +N E+ LEFF Sbjct: 57 TYCTKGSAKI-LKGDPCIKNLIFELNELEIEGIVEELSVENP-ESALEFF 104 >XP_016448794.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630, partial [Nicotiana tabacum] Length = 156 Score = 50.8 bits (120), Expect(2) = 1e-07 Identities = 23/40 (57%), Positives = 27/40 (67%) Frame = -2 Query: 121 FFAMRNGFGVKHSRSCFFFIAHVLAGMSRARALKFHLMNM 2 FF +RN +G KHSR +AHVLA R RALKFHL N+ Sbjct: 104 FFLLRNDYGFKHSRVSHIIVAHVLAKKQRFRALKFHLQNL 143 Score = 32.0 bits (71), Expect(2) = 1e-07 Identities = 33/110 (30%), Positives = 49/110 (44%), Gaps = 7/110 (6%) Frame = -3 Query: 426 MHRLTPKFPTSLKPHLISPLS-TFTTNLLEATPSPIDHPQNDVVSSILTHLTQPLMT--- 259 M RL K P KP L P S + A +DHP+ ++ ++T Sbjct: 1 MLRLILKCP--FKPQL--PYSFLLLKSSFSAASLAVDHPEPPTTTTTTKTAFSKILTFFQ 56 Query: 258 ---TKGSLNYSIKTRPLLKNLLTNIDPFQAEEIIISLFRKNQFETVLEFF 118 TKGS +K P +KNL+ ++ + E I+ L +N E+ LEFF Sbjct: 57 TYCTKGSAKL-LKGDPCIKNLIFELNELEIEGIVEELSVENP-ESALEFF 104 >XP_009782067.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana sylvestris] XP_009782072.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana sylvestris] XP_009782076.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana sylvestris] XP_009782082.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana sylvestris] XP_009782087.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana sylvestris] XP_009782097.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana sylvestris] XP_009782104.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Nicotiana sylvestris] Length = 807 Score = 50.4 bits (119), Expect(2) = 2e-07 Identities = 23/40 (57%), Positives = 27/40 (67%) Frame = -2 Query: 121 FFAMRNGFGVKHSRSCFFFIAHVLAGMSRARALKFHLMNM 2 FF +RN +G KHSR +AHVLA R RALKFHL N+ Sbjct: 103 FFLLRNDYGFKHSRVSHVIVAHVLAKKQRFRALKFHLQNL 142 Score = 31.6 bits (70), Expect(2) = 2e-07 Identities = 31/108 (28%), Positives = 51/108 (47%), Gaps = 5/108 (4%) Frame = -3 Query: 426 MHRLTPKFPTSLKPHLISPLSTFTTNLLEATPSPIDHPQNDVVSSILTHLTQPLM----- 262 M RL K P LKP L + ++ A+ + +DHP+ ++ + L Sbjct: 1 MLRLILKCP--LKPQLPYSILLLKSSFSAASLA-VDHPEPPPTTTTKIAFSNILSFFQTY 57 Query: 261 TTKGSLNYSIKTRPLLKNLLTNIDPFQAEEIIISLFRKNQFETVLEFF 118 TKGS +K P KNL+ ++ + E+I+ L +N ++ LEFF Sbjct: 58 CTKGSAKL-LKADPCYKNLIFELNELEIEDIVEKLSVENS-DSALEFF 103