BLASTX nr result
ID: Lithospermum23_contig00031922
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00031922 (212 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011072894.1 PREDICTED: exocyst complex component EXO70A1-like... 63 5e-10 >XP_011072894.1 PREDICTED: exocyst complex component EXO70A1-like [Sesamum indicum] XP_011072895.1 PREDICTED: exocyst complex component EXO70A1-like [Sesamum indicum] Length = 624 Score = 63.2 bits (152), Expect = 5e-10 Identities = 31/56 (55%), Positives = 40/56 (71%) Frame = +2 Query: 2 KAFISFWRCEMEEYLTILDMEPNSIEDVHKMESDYLNSKIKIWWRATIFILSLYLS 169 +AF FWR EYLTILD+E SIEDV +ME YLNS+I++W A I+S+YL+ Sbjct: 229 QAFCGFWRDTFTEYLTILDVEQFSIEDVLQMEWKYLNSRIRMWRHAVKSIISIYLA 284