BLASTX nr result
ID: Lithospermum23_contig00031826
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00031826 (363 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP07769.1 unnamed protein product [Coffea canephora] 64 2e-09 XP_002279621.1 PREDICTED: uncharacterized protein LOC100258531 [... 59 9e-08 EYU29020.1 hypothetical protein MIMGU_mgv1a020347mg, partial [Er... 55 6e-07 XP_012835555.1 PREDICTED: uncharacterized protein LOC105956253 i... 54 5e-06 >CDP07769.1 unnamed protein product [Coffea canephora] Length = 360 Score = 63.9 bits (154), Expect = 2e-09 Identities = 35/57 (61%), Positives = 40/57 (70%) Frame = -2 Query: 362 EQGILRELTQRNRDEEKEVYDGIKSNHHHVHGKQTSIIAEKEAKTLDVFWFLKPCTL 192 E+G+L+EL QRN DE+K G KSNH G +II EKEAK LDV WFLKPCTL Sbjct: 307 ERGVLQELGQRNFDEKKNEI-GKKSNH----GGHAAIIGEKEAKPLDVLWFLKPCTL 358 >XP_002279621.1 PREDICTED: uncharacterized protein LOC100258531 [Vitis vinifera] CBI24878.3 unnamed protein product, partial [Vitis vinifera] Length = 354 Score = 58.9 bits (141), Expect = 9e-08 Identities = 31/57 (54%), Positives = 40/57 (70%) Frame = -2 Query: 362 EQGILRELTQRNRDEEKEVYDGIKSNHHHVHGKQTSIIAEKEAKTLDVFWFLKPCTL 192 E+G+L+E+ Q N ++E G K N+ G SIIAE+EAKTLD+FWFLKPCTL Sbjct: 305 ERGLLQEIEQNNNNKE-----GDKGNN----GTTVSIIAEREAKTLDMFWFLKPCTL 352 >EYU29020.1 hypothetical protein MIMGU_mgv1a020347mg, partial [Erythranthe guttata] Length = 144 Score = 54.7 bits (130), Expect = 6e-07 Identities = 27/57 (47%), Positives = 36/57 (63%) Frame = -2 Query: 362 EQGILRELTQRNRDEEKEVYDGIKSNHHHVHGKQTSIIAEKEAKTLDVFWFLKPCTL 192 E+GIL+E+ N+D GIK + ++AEKEA++LDVFWFLKPCTL Sbjct: 92 ERGILQEVKATNKDV------GIKVERENKTNNNGGVVAEKEARSLDVFWFLKPCTL 142 >XP_012835555.1 PREDICTED: uncharacterized protein LOC105956253 isoform X1 [Erythranthe guttata] EYU38947.1 hypothetical protein MIMGU_mgv1a025948mg [Erythranthe guttata] Length = 372 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/57 (47%), Positives = 39/57 (68%) Frame = -2 Query: 362 EQGILRELTQRNRDEEKEVYDGIKSNHHHVHGKQTSIIAEKEAKTLDVFWFLKPCTL 192 E+GIL+E+ N+D +V K+N++ ++AEKEA++LDVFWFLKPCTL Sbjct: 320 ERGILQEVKATNKDAVMKVERENKTNNNG------GVVAEKEARSLDVFWFLKPCTL 370