BLASTX nr result
ID: Lithospermum23_contig00031793
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00031793 (971 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019163019.1 PREDICTED: two-component response regulator ARR17... 69 3e-11 XP_019163017.1 PREDICTED: two-component response regulator ARR17... 69 3e-11 CDP04042.1 unnamed protein product [Coffea canephora] 70 5e-11 XP_008360657.1 PREDICTED: two-component response regulator ARR17... 64 1e-08 XP_008228315.1 PREDICTED: two-component response regulator ARR17... 64 1e-08 KVH94142.1 CheY-like superfamily [Cynara cardunculus var. scolymus] 63 2e-08 XP_009364893.1 PREDICTED: two-component response regulator ARR17... 63 3e-08 ONK67949.1 uncharacterized protein A4U43_C05F5530 [Asparagus off... 62 4e-08 XP_015874676.1 PREDICTED: two-component response regulator ARR17... 62 7e-08 XP_007208607.1 hypothetical protein PRUPE_ppa021876mg [Prunus pe... 62 7e-08 XP_008245269.1 PREDICTED: two-component response regulator ARR17... 59 6e-07 ONK62581.1 uncharacterized protein A4U43_C07F5600 [Asparagus off... 57 3e-06 OIT26217.1 two-component response regulator orr4 [Nicotiana atte... 55 5e-06 >XP_019163019.1 PREDICTED: two-component response regulator ARR17-like isoform X2 [Ipomoea nil] Length = 95 Score = 68.9 bits (167), Expect = 3e-11 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -1 Query: 914 RCLEEGAQEFLLKPLKQSDVKKLRCHMTKVNHSSDGKLCIGR 789 +CLE GAQEF++KPLKQSDVKKLRCHM K G+LCIGR Sbjct: 54 KCLEGGAQEFMIKPLKQSDVKKLRCHMAKFKQPCSGRLCIGR 95 >XP_019163017.1 PREDICTED: two-component response regulator ARR17-like isoform X1 [Ipomoea nil] Length = 96 Score = 68.9 bits (167), Expect = 3e-11 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -1 Query: 914 RCLEEGAQEFLLKPLKQSDVKKLRCHMTKVNHSSDGKLCIGR 789 +CLE GAQEF++KPLKQSDVKKLRCHM K G+LCIGR Sbjct: 55 KCLEGGAQEFMIKPLKQSDVKKLRCHMAKFKQPCSGRLCIGR 96 >CDP04042.1 unnamed protein product [Coffea canephora] Length = 155 Score = 70.1 bits (170), Expect = 5e-11 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -1 Query: 911 CLEEGAQEFLLKPLKQSDVKKLRCHMTKVNHSSDGKLCIGR 789 CLEEGAQEF+LKPL QSDV KLRC+M K++H S G+LCIGR Sbjct: 115 CLEEGAQEFMLKPLNQSDVMKLRCYMMKLSHPSKGQLCIGR 155 >XP_008360657.1 PREDICTED: two-component response regulator ARR17-like [Malus domestica] Length = 167 Score = 63.5 bits (153), Expect = 1e-08 Identities = 26/43 (60%), Positives = 39/43 (90%), Gaps = 1/43 (2%) Frame = -1 Query: 914 RCLEEGAQEFLLKPLKQSDVKKLRCHMTKV-NHSSDGKLCIGR 789 +CLEEGA+EFLLKPL+Q+DVKKL+CH+++ N + +G++C+GR Sbjct: 125 KCLEEGAEEFLLKPLRQADVKKLKCHLSEFRNPNDEGRICLGR 167 >XP_008228315.1 PREDICTED: two-component response regulator ARR17-like [Prunus mume] Length = 170 Score = 63.5 bits (153), Expect = 1e-08 Identities = 29/44 (65%), Positives = 36/44 (81%), Gaps = 2/44 (4%) Frame = -1 Query: 914 RCLEEGAQEFLLKPLKQSDVKKLRCHMTK--VNHSSDGKLCIGR 789 +CLEEGA+EFLLKPL+ SDVKKLRCH+T N S +G +C+GR Sbjct: 127 KCLEEGAEEFLLKPLRLSDVKKLRCHLTSNAGNSSDEGLICVGR 170 >KVH94142.1 CheY-like superfamily [Cynara cardunculus var. scolymus] Length = 175 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -1 Query: 914 RCLEEGAQEFLLKPLKQSDVKKLRCHMTKVNHSSDGKLCIGR 789 +CLEEGAQEF+LKPLKQ+DVKKLRCHM + G+LC+GR Sbjct: 125 KCLEEGAQEFILKPLKQADVKKLRCHM-QFTKPMKGRLCMGR 165 >XP_009364893.1 PREDICTED: two-component response regulator ARR17-like [Pyrus x bretschneideri] Length = 167 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/43 (62%), Positives = 38/43 (88%), Gaps = 1/43 (2%) Frame = -1 Query: 914 RCLEEGAQEFLLKPLKQSDVKKLRCHMTKV-NHSSDGKLCIGR 789 +CLEEGA+EFLLKPL+Q+DVKKL+CH+++ N S +G+ C+GR Sbjct: 125 KCLEEGAEEFLLKPLRQADVKKLKCHLSEFRNPSDEGRNCLGR 167 >ONK67949.1 uncharacterized protein A4U43_C05F5530 [Asparagus officinalis] Length = 156 Score = 62.0 bits (149), Expect = 4e-08 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = -1 Query: 914 RCLEEGAQEFLLKPLKQSDVKKLRCHMTKVNHSSDGKLCIG 792 +CLE+GAQEF+LKPL+QSDVKKL+ HM K++ G+LC+G Sbjct: 115 KCLEDGAQEFMLKPLQQSDVKKLKYHMQKIDSHLHGRLCLG 155 >XP_015874676.1 PREDICTED: two-component response regulator ARR17-like [Ziziphus jujuba] Length = 202 Score = 62.4 bits (150), Expect = 7e-08 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = -1 Query: 914 RCLEEGAQEFLLKPLKQSDVKKLRCHMTKVNHSSDGKLCIGR 789 +CLEEGAQEF+LKPL+QSDVKKL C + K + + +LC+GR Sbjct: 161 KCLEEGAQEFMLKPLRQSDVKKLNCQLVKYRNPCNARLCMGR 202 >XP_007208607.1 hypothetical protein PRUPE_ppa021876mg [Prunus persica] ONH99648.1 hypothetical protein PRUPE_6G040900 [Prunus persica] Length = 170 Score = 61.6 bits (148), Expect = 7e-08 Identities = 27/43 (62%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = -1 Query: 914 RCLEEGAQEFLLKPLKQSDVKKLRCHMTKV-NHSSDGKLCIGR 789 +CLEEGA+EFLLKPL+QSDV +LRCH+ K+ N + +G +C+GR Sbjct: 128 KCLEEGAKEFLLKPLRQSDVNQLRCHLMKLGNPNDEGMVCMGR 170 >XP_008245269.1 PREDICTED: two-component response regulator ARR17-like [Prunus mume] Length = 172 Score = 58.9 bits (141), Expect = 6e-07 Identities = 27/43 (62%), Positives = 36/43 (83%), Gaps = 1/43 (2%) Frame = -1 Query: 914 RCLEEGAQEFLLKPLKQSDVKKLRCHMTKV-NHSSDGKLCIGR 789 +CLEEGA+EFLLKPL+QSDV +LR H+ K+ N S +G +C+GR Sbjct: 130 KCLEEGAKEFLLKPLRQSDVNQLRSHLMKLGNPSDEGMVCMGR 172 >ONK62581.1 uncharacterized protein A4U43_C07F5600 [Asparagus officinalis] Length = 171 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/42 (52%), Positives = 34/42 (80%) Frame = -1 Query: 914 RCLEEGAQEFLLKPLKQSDVKKLRCHMTKVNHSSDGKLCIGR 789 +CL++GAQ+F+LKP++QSDVK+L+CH+ K + LC+GR Sbjct: 130 KCLDDGAQDFILKPIQQSDVKRLKCHVQKFESPFNEMLCLGR 171 >OIT26217.1 two-component response regulator orr4 [Nicotiana attenuata] Length = 102 Score = 54.7 bits (130), Expect = 5e-06 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 3/38 (7%) Frame = -1 Query: 908 LEEGAQEFLLKPLKQSDVKKLRCHMTKV---NHSSDGK 804 LEEG QEF+LKPLKQSDVKKL+C+MTKV ++S GK Sbjct: 40 LEEGGQEFMLKPLKQSDVKKLKCNMTKVTEPGYTSGGK 77