BLASTX nr result
ID: Lithospermum23_contig00031542
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00031542 (246 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KVI08577.1 Armadillo-like helical [Cynara cardunculus var. scoly... 59 3e-08 XP_009351577.1 PREDICTED: U-box domain-containing protein 21-lik... 57 9e-08 XP_008381777.1 PREDICTED: U-box domain-containing protein 21-lik... 57 9e-08 XP_008350837.1 PREDICTED: U-box domain-containing protein 21-lik... 57 9e-08 XP_006469284.1 PREDICTED: U-box domain-containing protein 21 [Ci... 57 9e-08 XP_006448117.1 hypothetical protein CICLE_v10015253mg [Citrus cl... 57 9e-08 CDP05532.1 unnamed protein product [Coffea canephora] 57 1e-07 CDP01660.1 unnamed protein product [Coffea canephora] 57 1e-07 XP_010102878.1 U-box domain-containing protein 20 [Morus notabil... 57 2e-07 XP_012845005.1 PREDICTED: U-box domain-containing protein 21 [Er... 56 2e-07 OMP07906.1 hypothetical protein COLO4_06947 [Corchorus olitorius] 56 3e-07 XP_015880118.1 PREDICTED: U-box domain-containing protein 21-lik... 56 3e-07 XP_018807649.1 PREDICTED: U-box domain-containing protein 21-lik... 55 3e-07 XP_007224745.1 hypothetical protein PRUPE_ppa024359mg [Prunus pe... 55 4e-07 XP_008795339.1 PREDICTED: U-box domain-containing protein 21 [Ph... 55 6e-07 XP_018816549.1 PREDICTED: U-box domain-containing protein 21-lik... 55 8e-07 XP_018847095.1 PREDICTED: U-box domain-containing protein 21-lik... 55 8e-07 KZV46408.1 U-box domain-containing protein 21-like [Dorcoceras h... 55 8e-07 XP_004142305.1 PREDICTED: U-box domain-containing protein 21-lik... 54 1e-06 XP_019462126.1 PREDICTED: U-box domain-containing protein 21-lik... 54 1e-06 >KVI08577.1 Armadillo-like helical [Cynara cardunculus var. scolymus] Length = 437 Score = 58.5 bits (140), Expect = 3e-08 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -1 Query: 111 GQKIEFLEANKLELTIPIHFRCPISLDLMKDPVTLST 1 G+K + +K+ELTIP HFRCPISLDLMKDPVTLST Sbjct: 15 GKKFLHKQNSKIELTIPTHFRCPISLDLMKDPVTLST 51 >XP_009351577.1 PREDICTED: U-box domain-containing protein 21-like [Pyrus x bretschneideri] Length = 441 Score = 57.4 bits (137), Expect = 9e-08 Identities = 29/47 (61%), Positives = 34/47 (72%) Frame = -1 Query: 141 LLRGKKCSKKGQKIEFLEANKLELTIPIHFRCPISLDLMKDPVTLST 1 L G++ +K+G E +ELTIP HFRCPISLDLMKDPVTLST Sbjct: 8 LRAGRRAAKEG------ETGDMELTIPNHFRCPISLDLMKDPVTLST 48 >XP_008381777.1 PREDICTED: U-box domain-containing protein 21-like [Malus domestica] Length = 442 Score = 57.4 bits (137), Expect = 9e-08 Identities = 29/47 (61%), Positives = 34/47 (72%) Frame = -1 Query: 141 LLRGKKCSKKGQKIEFLEANKLELTIPIHFRCPISLDLMKDPVTLST 1 L G++ +K+G E +ELTIP HFRCPISLDLMKDPVTLST Sbjct: 8 LRAGRRAAKEG------ETGDMELTIPNHFRCPISLDLMKDPVTLST 48 >XP_008350837.1 PREDICTED: U-box domain-containing protein 21-like [Malus domestica] Length = 443 Score = 57.4 bits (137), Expect = 9e-08 Identities = 29/47 (61%), Positives = 35/47 (74%) Frame = -1 Query: 141 LLRGKKCSKKGQKIEFLEANKLELTIPIHFRCPISLDLMKDPVTLST 1 L G++ +K+G EA +ELTIP HFRCPISL+LMKDPVTLST Sbjct: 8 LRAGRRAAKEG------EAGDMELTIPNHFRCPISLELMKDPVTLST 48 >XP_006469284.1 PREDICTED: U-box domain-containing protein 21 [Citrus sinensis] KDO60832.1 hypothetical protein CISIN_1g038250mg [Citrus sinensis] Length = 444 Score = 57.4 bits (137), Expect = 9e-08 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = -1 Query: 135 RGKKCSKKGQKIEFLEANKLELTIPIHFRCPISLDLMKDPVTLST 1 RG++ KK +E ++ELT P HFRCPISLDLMKDPVTLST Sbjct: 12 RGRRAGKKQPGVE--SGGEMELTTPNHFRCPISLDLMKDPVTLST 54 >XP_006448117.1 hypothetical protein CICLE_v10015253mg [Citrus clementina] ESR61357.1 hypothetical protein CICLE_v10015253mg [Citrus clementina] Length = 444 Score = 57.4 bits (137), Expect = 9e-08 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = -1 Query: 135 RGKKCSKKGQKIEFLEANKLELTIPIHFRCPISLDLMKDPVTLST 1 RG++ KK +E ++ELT P HFRCPISLDLMKDPVTLST Sbjct: 12 RGRRAGKKQPGVE--SGGEMELTTPNHFRCPISLDLMKDPVTLST 54 >CDP05532.1 unnamed protein product [Coffea canephora] Length = 363 Score = 57.0 bits (136), Expect = 1e-07 Identities = 28/46 (60%), Positives = 36/46 (78%), Gaps = 1/46 (2%) Frame = -1 Query: 135 RGKKCSKKGQKIEFLEA-NKLELTIPIHFRCPISLDLMKDPVTLST 1 R K+ +++ K + LE + +ELTIP HFRCPISL+LMKDPVTLST Sbjct: 6 RKKRAARRAAKKQNLEVTSNMELTIPSHFRCPISLELMKDPVTLST 51 >CDP01660.1 unnamed protein product [Coffea canephora] Length = 442 Score = 57.0 bits (136), Expect = 1e-07 Identities = 32/48 (66%), Positives = 37/48 (77%), Gaps = 3/48 (6%) Frame = -1 Query: 135 RGKKCSKKGQ--KIEFLEAN-KLELTIPIHFRCPISLDLMKDPVTLST 1 R K+ +++ Q K E LE N LELTIP HF+CPISLDLMKDPVTLST Sbjct: 6 RHKRANRRRQARKNEALEGNCDLELTIPKHFQCPISLDLMKDPVTLST 53 >XP_010102878.1 U-box domain-containing protein 20 [Morus notabilis] EXB94294.1 U-box domain-containing protein 20 [Morus notabilis] Length = 455 Score = 56.6 bits (135), Expect = 2e-07 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = -1 Query: 138 LRGKKCSKKGQKIEFLEANKLELTIPIHFRCPISLDLMKDPVTLST 1 LR ++ +KK +I ++ E+ IP HFRCPI+LDLMKDPVTLST Sbjct: 5 LRRRRANKKKTQIPESDSEMTEIVIPAHFRCPITLDLMKDPVTLST 50 >XP_012845005.1 PREDICTED: U-box domain-containing protein 21 [Erythranthe guttata] EYU30866.1 hypothetical protein MIMGU_mgv1a026315mg [Erythranthe guttata] Length = 452 Score = 56.2 bits (134), Expect = 2e-07 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = -1 Query: 132 GKKCSKKGQKIEFLEANKLELTIPIHFRCPISLDLMKDPVTLST 1 GK + KG + + +ELTIP+HF+CPISLDLMKDPVTLST Sbjct: 16 GKDETSKG----IINQDSMELTIPVHFKCPISLDLMKDPVTLST 55 >OMP07906.1 hypothetical protein COLO4_06947 [Corchorus olitorius] Length = 443 Score = 55.8 bits (133), Expect = 3e-07 Identities = 28/45 (62%), Positives = 32/45 (71%) Frame = -1 Query: 135 RGKKCSKKGQKIEFLEANKLELTIPIHFRCPISLDLMKDPVTLST 1 R + KK +K + +ELTIP HFRCPISLDLMKDPVTLST Sbjct: 6 RKPRAIKKSKKQIPFDELDMELTIPTHFRCPISLDLMKDPVTLST 50 >XP_015880118.1 PREDICTED: U-box domain-containing protein 21-like [Ziziphus jujuba] Length = 445 Score = 55.8 bits (133), Expect = 3e-07 Identities = 25/45 (55%), Positives = 33/45 (73%) Frame = -1 Query: 135 RGKKCSKKGQKIEFLEANKLELTIPIHFRCPISLDLMKDPVTLST 1 R + + K + ++ ++E+TIP HFRCPISLDLMKDPVTLST Sbjct: 9 RAGRRANKNSVNDDIDGTEMEITIPTHFRCPISLDLMKDPVTLST 53 >XP_018807649.1 PREDICTED: U-box domain-containing protein 21-like [Juglans regia] Length = 184 Score = 54.7 bits (130), Expect = 3e-07 Identities = 29/47 (61%), Positives = 36/47 (76%), Gaps = 2/47 (4%) Frame = -1 Query: 135 RGKKCSKKGQKI-EFLEAN-KLELTIPIHFRCPISLDLMKDPVTLST 1 R + S+ G KI E L+ N + E+TIP +FRCPISLDLM+DPVTLST Sbjct: 6 RRLRASRGGNKISELLDGNLQTEITIPTYFRCPISLDLMRDPVTLST 52 >XP_007224745.1 hypothetical protein PRUPE_ppa024359mg [Prunus persica] ONI31874.1 hypothetical protein PRUPE_1G336200 [Prunus persica] Length = 447 Score = 55.5 bits (132), Expect = 4e-07 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -1 Query: 132 GKKCSKKGQKIEFLEANKLELTIPIHFRCPISLDLMKDPVTLST 1 G++ SK+ Q E + ++ELTIP HFRCPISLDLMKDPVTLST Sbjct: 11 GRRASKELQLGEPADV-EMELTIPNHFRCPISLDLMKDPVTLST 53 >XP_008795339.1 PREDICTED: U-box domain-containing protein 21 [Phoenix dactylifera] Length = 446 Score = 55.1 bits (131), Expect = 6e-07 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 5/44 (11%) Frame = -1 Query: 117 KKGQKIEFLEANK-----LELTIPIHFRCPISLDLMKDPVTLST 1 K+GQKI F++ + +E +IP HFRCPISLDLMKDPVT+ST Sbjct: 9 KRGQKIPFVKRSPVGNPFMEPSIPTHFRCPISLDLMKDPVTVST 52 >XP_018816549.1 PREDICTED: U-box domain-containing protein 21-like [Juglans regia] Length = 442 Score = 54.7 bits (130), Expect = 8e-07 Identities = 28/45 (62%), Positives = 35/45 (77%), Gaps = 2/45 (4%) Frame = -1 Query: 129 KKCSKKGQ-KIEFLEAN-KLELTIPIHFRCPISLDLMKDPVTLST 1 ++ S+ G K E L+ N +E+TIP HF+CPISLDLMKDPVTLST Sbjct: 7 RRASRGGNNKSELLDGNLHMEITIPSHFQCPISLDLMKDPVTLST 51 >XP_018847095.1 PREDICTED: U-box domain-containing protein 21-like [Juglans regia] Length = 445 Score = 54.7 bits (130), Expect = 8e-07 Identities = 29/47 (61%), Positives = 36/47 (76%), Gaps = 2/47 (4%) Frame = -1 Query: 135 RGKKCSKKGQKI-EFLEAN-KLELTIPIHFRCPISLDLMKDPVTLST 1 R + S+ G KI E L+ N + E+TIP +FRCPISLDLM+DPVTLST Sbjct: 6 RRLRASRGGNKISELLDGNLQTEITIPTYFRCPISLDLMRDPVTLST 52 >KZV46408.1 U-box domain-containing protein 21-like [Dorcoceras hygrometricum] Length = 449 Score = 54.7 bits (130), Expect = 8e-07 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -1 Query: 114 KGQKIEFLEANKLELTIPIHFRCPISLDLMKDPVTLST 1 K + IE + +ELTIP HFRCPISLDLMKDPVTLST Sbjct: 16 KKKSIEEDDNANMELTIPNHFRCPISLDLMKDPVTLST 53 >XP_004142305.1 PREDICTED: U-box domain-containing protein 21-like [Cucumis sativus] KGN49607.1 hypothetical protein Csa_5G023870 [Cucumis sativus] Length = 444 Score = 54.3 bits (129), Expect = 1e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -1 Query: 87 ANKLELTIPIHFRCPISLDLMKDPVTLST 1 ++ +ELTIP HFRCPISLDLMKDPVTLST Sbjct: 20 SHTIELTIPTHFRCPISLDLMKDPVTLST 48 >XP_019462126.1 PREDICTED: U-box domain-containing protein 21-like [Lupinus angustifolius] OIW02646.1 hypothetical protein TanjilG_29422 [Lupinus angustifolius] Length = 439 Score = 53.9 bits (128), Expect = 1e-06 Identities = 22/40 (55%), Positives = 33/40 (82%) Frame = -1 Query: 120 SKKGQKIEFLEANKLELTIPIHFRCPISLDLMKDPVTLST 1 S+KG+++ + ++E+ IP HFRCP++LD+MKDPVTLST Sbjct: 14 SRKGKELNSVGDLEVEIAIPTHFRCPVTLDMMKDPVTLST 53