BLASTX nr result
ID: Lithospermum23_contig00031501
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00031501 (415 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAC57371.1 hypothetical protein [Oryza sativa Japonica Group] 54 2e-07 KMT04721.1 hypothetical protein BVRB_7g169020 [Beta vulgaris sub... 54 1e-06 KDP40619.1 hypothetical protein JCGZ_24618 [Jatropha curcas] 53 2e-06 OIT05209.1 hypothetical protein A4A49_02756 [Nicotiana attenuata] 52 3e-06 >BAC57371.1 hypothetical protein [Oryza sativa Japonica Group] Length = 65 Score = 54.3 bits (129), Expect = 2e-07 Identities = 26/56 (46%), Positives = 40/56 (71%), Gaps = 1/56 (1%) Frame = +2 Query: 161 MMTTQRGSSRAAVHGSNFPSQDT-EDKEKVEEVSNKGKEQREKIRDDVENKVDSEL 325 M T +G++RAAVHGS P+ T +KE+VE +G+EQ+ K R++VE+KVD+ + Sbjct: 1 MGTVAKGTTRAAVHGSRSPATTTLHNKEEVETAVERGREQKHKAREEVEDKVDASI 56 >KMT04721.1 hypothetical protein BVRB_7g169020 [Beta vulgaris subsp. vulgaris] Length = 106 Score = 53.5 bits (127), Expect = 1e-06 Identities = 31/104 (29%), Positives = 55/104 (52%), Gaps = 1/104 (0%) Frame = +2 Query: 41 MKMKVIRLVAIIGRNNGQLGQECLLSNGIFFSQVVSLRKMMMTTQRGSSRAAVHGSNFPS 220 MK+ ++A + R N G + N + + ++M+ R ++R+ +HG++ P+ Sbjct: 1 MKVMSPTMLAFLLRENRPAGANSAICNNVNMKKRTQQHRLMVG--RANNRSGIHGTHLPT 58 Query: 221 QDTEDK-EKVEEVSNKGKEQREKIRDDVENKVDSELKGEGNKTK 349 DT D E+V+ NKGK+++E+ R +VE VDS L K Sbjct: 59 TDTLDNVEEVKREINKGKKEKEEKRKNVEETVDSHLSRSDQNQK 102 >KDP40619.1 hypothetical protein JCGZ_24618 [Jatropha curcas] Length = 88 Score = 52.8 bits (125), Expect = 2e-06 Identities = 27/57 (47%), Positives = 42/57 (73%) Frame = +2 Query: 149 LRKMMMTTQRGSSRAAVHGSNFPSQDTEDKEKVEEVSNKGKEQREKIRDDVENKVDS 319 L K ++TT + S+RAAVHG+ P +T +KE+ E+ +KGKE++EK R++VE V+S Sbjct: 27 LMKRLITT-KASNRAAVHGTKRPVTETINKEEAEKEISKGKEEKEKKREEVEKTVNS 82 >OIT05209.1 hypothetical protein A4A49_02756 [Nicotiana attenuata] Length = 89 Score = 52.0 bits (123), Expect = 3e-06 Identities = 24/63 (38%), Positives = 39/63 (61%) Frame = +2 Query: 140 VVSLRKMMMTTQRGSSRAAVHGSNFPSQDTEDKEKVEEVSNKGKEQREKIRDDVENKVDS 319 VV + + ++R+AVHG+ P D DKE+VE N +E++E+ R ++EN +DS Sbjct: 16 VVFRHNTLRLVGKAANRSAVHGTKLPIPDVVDKEQVEAEINPAREEKERKRRELENAIDS 75 Query: 320 ELK 328 +LK Sbjct: 76 QLK 78