BLASTX nr result
ID: Lithospermum23_contig00031416
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00031416 (1005 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004290609.1 PREDICTED: 40S ribosomal protein S18 [Fragaria ve... 62 3e-08 XP_006306532.1 hypothetical protein CARUB_v10012556mg, partial [... 60 1e-07 AAK43840.1 S18.A ribosomal protein [Arabidopsis thaliana] AAL473... 60 2e-07 NP_173692.1 Ribosomal protein S13/S18 family [Arabidopsis thalia... 60 2e-07 AHH02826.1 ribosomal protein S18, partial [Trifolium repens] 59 2e-07 XP_013469607.1 ribosomal protein S13P/S18e [Medicago truncatula]... 59 2e-07 KYP59924.1 40S ribosomal protein S18 [Cajanus cajan] 59 3e-07 XP_003612677.2 ribosomal protein S13P/S18e [Medicago truncatula]... 58 3e-07 XP_006288747.1 hypothetical protein CARUB_v10002063mg, partial [... 60 3e-07 XP_019427792.1 PREDICTED: 40S ribosomal protein S18-like [Lupinu... 59 3e-07 XP_019427270.1 PREDICTED: 40S ribosomal protein S18 [Lupinus ang... 59 3e-07 XP_003592049.1 ribosomal protein S13P/S18e [Medicago truncatula]... 59 3e-07 XP_010534126.1 PREDICTED: 40S ribosomal protein S18 [Tarenaya ha... 59 3e-07 XP_010542963.1 PREDICTED: 40S ribosomal protein S18 [Tarenaya ha... 59 3e-07 KFK44369.1 hypothetical protein AALP_AA1G248300 [Arabis alpina] 59 3e-07 XP_008224314.1 PREDICTED: 40S ribosomal protein S18 [Prunus mume... 59 3e-07 XP_002307515.1 40S ribosomal protein S18 [Populus trichocarpa] E... 59 3e-07 XP_007200472.1 hypothetical protein PRUPE_ppa012853mg [Prunus pe... 59 3e-07 GAU13311.1 hypothetical protein TSUD_42650, partial [Trifolium s... 57 4e-07 KYP50563.1 40S ribosomal protein S18, partial [Cajanus cajan] 59 5e-07 >XP_004290609.1 PREDICTED: 40S ribosomal protein S18 [Fragaria vesca subsp. vesca] Length = 152 Score = 62.4 bits (150), Expect = 3e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 915 RAGELSAAEIDNIMTIVGNPRQFNIPDWFL 1004 RAGELSAAEIDN+MTIVGNPRQF IPDWFL Sbjct: 55 RAGELSAAEIDNLMTIVGNPRQFKIPDWFL 84 >XP_006306532.1 hypothetical protein CARUB_v10012556mg, partial [Capsella rubella] EOA39430.1 hypothetical protein CARUB_v10012556mg, partial [Capsella rubella] Length = 122 Score = 60.1 bits (144), Expect = 1e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 915 RAGELSAAEIDNIMTIVGNPRQFNIPDWFL 1004 RAGELSAAEIDN+MTIV NPRQF IPDWFL Sbjct: 60 RAGELSAAEIDNLMTIVANPRQFKIPDWFL 89 >AAK43840.1 S18.A ribosomal protein [Arabidopsis thaliana] AAL47385.1 S18.A ribosomal protein [Arabidopsis thaliana] Length = 152 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 915 RAGELSAAEIDNIMTIVGNPRQFNIPDWFL 1004 RAGELSAAEIDN+MTIV NPRQF IPDWFL Sbjct: 55 RAGELSAAEIDNLMTIVANPRQFKIPDWFL 84 >NP_173692.1 Ribosomal protein S13/S18 family [Arabidopsis thaliana] NP_192718.1 S18 ribosomal protein [Arabidopsis thaliana] NP_564434.1 Ribosomal protein S13/S18 family [Arabidopsis thaliana] XP_002872461.1 hypothetical protein ARALYDRAFT_489832 [Arabidopsis lyrata subsp. lyrata] XP_002890533.1 hypothetical protein ARALYDRAFT_472522 [Arabidopsis lyrata subsp. lyrata] XP_002893800.1 hypothetical protein ARALYDRAFT_473557 [Arabidopsis lyrata subsp. lyrata] XP_010460045.1 PREDICTED: 40S ribosomal protein S18 [Camelina sativa] P34788.1 RecName: Full=40S ribosomal protein S18 AAG12534.1 ribosomal protein S18 [Arabidopsis thaliana] AAG12853.1 40S ribosomal protein S18; 25853-24673 [Arabidopsis thaliana] AAK62386.1 S18.A ribosomal protein [Arabidopsis thaliana] AAL06471.1 At1g22780/T22J18_5 [Arabidopsis thaliana] CAA80684.1 ribosomal protein S18A [Arabidopsis thaliana] CAA82273.1 S18 ribosomal protein [Arabidopsis thaliana] CAA82274.1 S18 ribosomal protein [Arabidopsis thaliana] CAA82275.1 S18 ribosomal protein [Arabidopsis thaliana] CAA72909.1 ribosomal protein S18A [Arabidopsis thaliana] AAC25506.1 Match to ribosomal S18 gene mRNA gb|Z28701, DNA gb|Z23165 from A. thaliana. ESTs gb|T21121, gb|Z17755, gb|R64776 and gb|R30430 come from this gene [Arabidopsis thaliana] CAB39647.1 S18.A ribosomal protein [Arabidopsis thaliana] CAB78103.1 S18.A ribosomal protein [Arabidopsis thaliana] AAK59471.1 putative ribosomal protein S18 [Arabidopsis thaliana] AAL47500.1 putative ribosomal protein S18 [Arabidopsis thaliana] AAM63849.1 ribosomal protein S18, putative [Arabidopsis thaliana] AAM64403.1 ribosomal protein S18, putative [Arabidopsis thaliana] AAM64976.1 ribosomal protein S18, putative [Arabidopsis thaliana] AAP21347.1 At4g09800 [Arabidopsis thaliana] AAV84519.1 At1g22780 [Arabidopsis thaliana] ABF59028.1 At1g22780 [Arabidopsis thaliana] ABP96570.1 pointed first leaf [Arabidopsis thaliana] ABP96571.1 pointed first leaf [Arabidopsis thaliana] ABP96572.1 pointed first leaf [Arabidopsis thaliana] ABP96573.1 pointed first leaf [Arabidopsis thaliana] ABP96574.1 pointed first leaf [Arabidopsis thaliana] ABP96575.1 pointed first leaf [Arabidopsis thaliana] ABP96576.1 pointed first leaf [Arabidopsis thaliana] ABP96577.1 pointed first leaf [Arabidopsis thaliana] ABP96578.1 pointed first leaf [Arabidopsis thaliana] ABP96579.1 pointed first leaf [Arabidopsis thaliana] ABP96580.1 pointed first leaf [Arabidopsis thaliana] ABP96581.1 pointed first leaf [Arabidopsis thaliana] ABP96582.1 pointed first leaf [Arabidopsis thaliana] ABP96583.1 pointed first leaf [Arabidopsis thaliana] ABP96584.1 pointed first leaf [Arabidopsis thaliana] ABP96585.1 pointed first leaf [Arabidopsis thaliana] ABP96586.1 pointed first leaf [Arabidopsis thaliana] ABP96587.1 pointed first leaf [Arabidopsis thaliana] ABP96588.1 pointed first leaf [Arabidopsis thaliana] ABP96589.1 pointed first leaf [Arabidopsis thaliana] ABP96590.1 pointed first leaf [Arabidopsis thaliana] EFH48720.1 hypothetical protein ARALYDRAFT_489832 [Arabidopsis lyrata subsp. lyrata] EFH66792.1 hypothetical protein ARALYDRAFT_472522 [Arabidopsis lyrata subsp. lyrata] EFH70059.1 hypothetical protein ARALYDRAFT_473557 [Arabidopsis lyrata subsp. lyrata] AEE30287.1 Ribosomal protein S13/S18 family [Arabidopsis thaliana] AEE31659.1 Ribosomal protein S13/S18 family [Arabidopsis thaliana] AEE82800.1 S18 ribosomal protein [Arabidopsis thaliana] OAP00728.1 hypothetical protein AXX17_AT4G10990 [Arabidopsis thaliana] OAP14104.1 hypothetical protein AXX17_AT1G23910 [Arabidopsis thaliana] Length = 152 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 915 RAGELSAAEIDNIMTIVGNPRQFNIPDWFL 1004 RAGELSAAEIDN+MTIV NPRQF IPDWFL Sbjct: 55 RAGELSAAEIDNLMTIVANPRQFKIPDWFL 84 >AHH02826.1 ribosomal protein S18, partial [Trifolium repens] Length = 98 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 915 RAGELSAAEIDNIMTIVGNPRQFNIPDWFL 1004 RAGELSAAE+DN+MT+V NPRQF +PDWFL Sbjct: 39 RAGELSAAELDNLMTVVANPRQFKVPDWFL 68 >XP_013469607.1 ribosomal protein S13P/S18e [Medicago truncatula] KEH43645.1 ribosomal protein S13P/S18e [Medicago truncatula] Length = 132 Score = 59.3 bits (142), Expect = 2e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 915 RAGELSAAEIDNIMTIVGNPRQFNIPDWFL 1004 RAGELSAAE+DNIMT+V NPRQF +PDWFL Sbjct: 55 RAGELSAAELDNIMTVVANPRQFKVPDWFL 84 >KYP59924.1 40S ribosomal protein S18 [Cajanus cajan] Length = 126 Score = 58.9 bits (141), Expect = 3e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 915 RAGELSAAEIDNIMTIVGNPRQFNIPDWFL 1004 RAGELSAAE+DN+MT+V NPRQF IPDWFL Sbjct: 29 RAGELSAAELDNLMTVVANPRQFKIPDWFL 58 >XP_003612677.2 ribosomal protein S13P/S18e [Medicago truncatula] AES95635.2 ribosomal protein S13P/S18e [Medicago truncatula] Length = 89 Score = 57.8 bits (138), Expect = 3e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 915 RAGELSAAEIDNIMTIVGNPRQFNIPDWFL 1004 RAG+LSAAE+DNIMT+V NPRQF +PDWFL Sbjct: 4 RAGKLSAAELDNIMTVVANPRQFKVPDWFL 33 >XP_006288747.1 hypothetical protein CARUB_v10002063mg, partial [Capsella rubella] EOA21645.1 hypothetical protein CARUB_v10002063mg, partial [Capsella rubella] Length = 183 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 915 RAGELSAAEIDNIMTIVGNPRQFNIPDWFL 1004 RAGELSAAEIDN+MTIV NPRQF IPDWFL Sbjct: 86 RAGELSAAEIDNLMTIVANPRQFKIPDWFL 115 >XP_019427792.1 PREDICTED: 40S ribosomal protein S18-like [Lupinus angustifolius] OIV91426.1 hypothetical protein TanjilG_02044 [Lupinus angustifolius] Length = 152 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 915 RAGELSAAEIDNIMTIVGNPRQFNIPDWFL 1004 RAGELSAAE+DNIMT++ NPRQF IPDWFL Sbjct: 55 RAGELSAAELDNIMTVIANPRQFKIPDWFL 84 >XP_019427270.1 PREDICTED: 40S ribosomal protein S18 [Lupinus angustifolius] OIV91417.1 hypothetical protein TanjilG_02035 [Lupinus angustifolius] Length = 152 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 915 RAGELSAAEIDNIMTIVGNPRQFNIPDWFL 1004 RAGELSAAE+DNIMT++ NPRQF IPDWFL Sbjct: 55 RAGELSAAELDNIMTVIANPRQFKIPDWFL 84 >XP_003592049.1 ribosomal protein S13P/S18e [Medicago truncatula] XP_003592054.1 ribosomal protein S13P/S18e [Medicago truncatula] ACJ85981.1 unknown [Medicago truncatula] AES62300.1 ribosomal protein S13P/S18e [Medicago truncatula] AES62305.1 ribosomal protein S13P/S18e [Medicago truncatula] AFK46616.1 unknown [Medicago truncatula] Length = 152 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 915 RAGELSAAEIDNIMTIVGNPRQFNIPDWFL 1004 RAGELSAAE+DNIMT+V NPRQF +PDWFL Sbjct: 55 RAGELSAAELDNIMTVVANPRQFKVPDWFL 84 >XP_010534126.1 PREDICTED: 40S ribosomal protein S18 [Tarenaya hassleriana] XP_010538910.1 PREDICTED: 40S ribosomal protein S18 [Tarenaya hassleriana] Length = 152 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 915 RAGELSAAEIDNIMTIVGNPRQFNIPDWFL 1004 RAGELSAAE+DN+MTIV NPRQF IPDWFL Sbjct: 55 RAGELSAAELDNLMTIVANPRQFKIPDWFL 84 >XP_010542963.1 PREDICTED: 40S ribosomal protein S18 [Tarenaya hassleriana] XP_010530129.1 PREDICTED: 40S ribosomal protein S18-like [Tarenaya hassleriana] Length = 152 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 915 RAGELSAAEIDNIMTIVGNPRQFNIPDWFL 1004 RAGELSAAE+DN+MTIV NPRQF IPDWFL Sbjct: 55 RAGELSAAELDNLMTIVANPRQFKIPDWFL 84 >KFK44369.1 hypothetical protein AALP_AA1G248300 [Arabis alpina] Length = 152 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 915 RAGELSAAEIDNIMTIVGNPRQFNIPDWFL 1004 RAGELSAAE+DN+MTIV NPRQF IPDWFL Sbjct: 55 RAGELSAAELDNLMTIVANPRQFKIPDWFL 84 >XP_008224314.1 PREDICTED: 40S ribosomal protein S18 [Prunus mume] XP_008390888.1 PREDICTED: 40S ribosomal protein S18 [Malus domestica] XP_008340984.1 PREDICTED: 40S ribosomal protein S18 [Malus domestica] XP_009369842.1 PREDICTED: 40S ribosomal protein S18 [Pyrus x bretschneideri] XP_009344099.1 PREDICTED: 40S ribosomal protein S18 isoform X1 [Pyrus x bretschneideri] XP_009344100.1 PREDICTED: 40S ribosomal protein S18 isoform X2 [Pyrus x bretschneideri] Length = 152 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 915 RAGELSAAEIDNIMTIVGNPRQFNIPDWFL 1004 RAGELSAAE+DN+MTIV NPRQF IPDWFL Sbjct: 55 RAGELSAAELDNLMTIVANPRQFKIPDWFL 84 >XP_002307515.1 40S ribosomal protein S18 [Populus trichocarpa] EEE94511.1 40S ribosomal protein S18 [Populus trichocarpa] Length = 152 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 915 RAGELSAAEIDNIMTIVGNPRQFNIPDWFL 1004 RAGELSAAE+DN+MTIV NPRQF IPDWFL Sbjct: 55 RAGELSAAELDNLMTIVANPRQFKIPDWFL 84 >XP_007200472.1 hypothetical protein PRUPE_ppa012853mg [Prunus persica] XP_008235305.1 PREDICTED: 40S ribosomal protein S18-like [Prunus mume] ONH93565.1 hypothetical protein PRUPE_8G238900 [Prunus persica] Length = 152 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 915 RAGELSAAEIDNIMTIVGNPRQFNIPDWFL 1004 RAGELSAAE+DN+MTIV NPRQF IPDWFL Sbjct: 55 RAGELSAAELDNLMTIVANPRQFKIPDWFL 84 >GAU13311.1 hypothetical protein TSUD_42650, partial [Trifolium subterraneum] Length = 64 Score = 56.6 bits (135), Expect = 4e-07 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +3 Query: 918 AGELSAAEIDNIMTIVGNPRQFNIPDWFL 1004 AGELSAAE+DN+MT+V NPRQF +PDWFL Sbjct: 1 AGELSAAELDNLMTVVANPRQFKVPDWFL 29 >KYP50563.1 40S ribosomal protein S18, partial [Cajanus cajan] Length = 151 Score = 58.9 bits (141), Expect = 5e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 915 RAGELSAAEIDNIMTIVGNPRQFNIPDWFL 1004 RAGELSAAE+DN+MT+V NPRQF IPDWFL Sbjct: 54 RAGELSAAELDNLMTVVANPRQFKIPDWFL 83