BLASTX nr result
ID: Lithospermum23_contig00031384
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00031384 (285 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010097430.1 DNA topoisomerase 2 [Morus notabilis] EXB68160.1 ... 57 2e-07 >XP_010097430.1 DNA topoisomerase 2 [Morus notabilis] EXB68160.1 DNA topoisomerase 2 [Morus notabilis] Length = 1451 Score = 57.0 bits (136), Expect = 2e-07 Identities = 29/55 (52%), Positives = 41/55 (74%) Frame = -2 Query: 284 KKVRKMRSSPFNKKSGSVLGRSNTLGMDSLDETEEQGSPDQESGSSTVDAVEDIV 120 KKVRKMR+SPFNKKSGSVLGR+ ++D+ +E + QE+ ST ++V+D+V Sbjct: 1362 KKVRKMRASPFNKKSGSVLGRA-----VNIDDDDEATTASQENSPSTSESVDDVV 1411