BLASTX nr result
ID: Lithospermum23_contig00031243
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00031243 (327 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006473771.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 4e-12 XP_016737585.1 PREDICTED: ACT domain-containing protein ACR8-lik... 65 2e-11 KDO85079.1 hypothetical protein CISIN_1g0057291mg, partial [Citr... 64 4e-11 XP_016706696.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 6e-11 XP_016706693.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 7e-11 XP_012437179.1 PREDICTED: ACT domain-containing protein ACR8-lik... 63 8e-11 CDP07298.1 unnamed protein product [Coffea canephora] 67 1e-10 XP_006473770.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 1e-10 XP_016682956.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 2e-10 XP_019190034.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 3e-10 NP_001333499.1 pentatricopeptide repeat-containing protein [Sola... 66 3e-10 XP_015085397.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 3e-10 XP_019240000.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 3e-10 XP_009784787.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 3e-10 XP_009606848.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 3e-10 KYP47801.1 hypothetical protein KK1_030565 [Cajanus cajan] 65 5e-10 KHN33805.1 Pentatricopeptide repeat-containing protein, mitochon... 65 5e-10 KHN20117.1 Pentatricopeptide repeat-containing protein, mitochon... 65 5e-10 XP_003523110.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 5e-10 XP_003527377.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 5e-10 >XP_006473771.1 PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Citrus sinensis] XP_006473772.1 PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Citrus sinensis] Length = 99 Score = 66.6 bits (161), Expect = 4e-12 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +3 Query: 3 VPAVYEEMLSSGCTPDRKARAMLRSALRYMKSSLQ 107 VPAVYEEM+SSGCTPDRKARAMLRSALRYMK +L+ Sbjct: 64 VPAVYEEMISSGCTPDRKARAMLRSALRYMKQTLK 98 >XP_016737585.1 PREDICTED: ACT domain-containing protein ACR8-like [Gossypium hirsutum] Length = 87 Score = 64.7 bits (156), Expect = 2e-11 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +3 Query: 3 VPAVYEEMLSSGCTPDRKARAMLRSALRYMKSSLQL 110 VPAVYEEM+ SGCTPDRKARAMLRSALRYMK +++L Sbjct: 43 VPAVYEEMILSGCTPDRKARAMLRSALRYMKQAVKL 78 >KDO85079.1 hypothetical protein CISIN_1g0057291mg, partial [Citrus sinensis] Length = 111 Score = 64.3 bits (155), Expect = 4e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 3 VPAVYEEMLSSGCTPDRKARAMLRSALRYMKSSLQ 107 VPAVYEEM+ SGCTPDRKARAMLRSALRYMK +L+ Sbjct: 76 VPAVYEEMILSGCTPDRKARAMLRSALRYMKQTLK 110 >XP_016706696.1 PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X2 [Gossypium hirsutum] Length = 85 Score = 63.2 bits (152), Expect = 6e-11 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +3 Query: 3 VPAVYEEMLSSGCTPDRKARAMLRSALRYMKSSLQ 107 VPAVYEEM+ SGCTPDRKARAMLRSALRYMK +++ Sbjct: 41 VPAVYEEMILSGCTPDRKARAMLRSALRYMKQAVK 75 >XP_016706693.1 PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Gossypium hirsutum] XP_016706694.1 PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Gossypium hirsutum] XP_016706695.1 PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Gossypium hirsutum] Length = 93 Score = 63.2 bits (152), Expect = 7e-11 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +3 Query: 3 VPAVYEEMLSSGCTPDRKARAMLRSALRYMKSSLQ 107 VPAVYEEM+ SGCTPDRKARAMLRSALRYMK +++ Sbjct: 49 VPAVYEEMILSGCTPDRKARAMLRSALRYMKQAVK 83 >XP_012437179.1 PREDICTED: ACT domain-containing protein ACR8-like [Gossypium raimondii] XP_012437180.1 PREDICTED: ACT domain-containing protein ACR8-like [Gossypium raimondii] XP_012437182.1 PREDICTED: ACT domain-containing protein ACR8-like [Gossypium raimondii] Length = 96 Score = 63.2 bits (152), Expect = 8e-11 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +3 Query: 3 VPAVYEEMLSSGCTPDRKARAMLRSALRYMKSSLQ 107 VPAVYEEM+ SGCTPDRKARAMLRSALRYMK +++ Sbjct: 43 VPAVYEEMILSGCTPDRKARAMLRSALRYMKQAVK 77 >CDP07298.1 unnamed protein product [Coffea canephora] Length = 735 Score = 67.0 bits (162), Expect = 1e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +3 Query: 3 VPAVYEEMLSSGCTPDRKARAMLRSALRYMKSSLQL 110 VPAVYEEMLSSGC PDRKARAMLRSALRYMKS+L++ Sbjct: 700 VPAVYEEMLSSGCLPDRKARAMLRSALRYMKSTLKV 735 >XP_006473770.1 PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Citrus sinensis] Length = 704 Score = 66.6 bits (161), Expect = 1e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +3 Query: 3 VPAVYEEMLSSGCTPDRKARAMLRSALRYMKSSLQ 107 VPAVYEEM+SSGCTPDRKARAMLRSALRYMK +L+ Sbjct: 669 VPAVYEEMISSGCTPDRKARAMLRSALRYMKQTLK 703 >XP_016682956.1 PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Gossypium hirsutum] Length = 77 Score = 61.6 bits (148), Expect = 2e-10 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +3 Query: 3 VPAVYEEMLSSGCTPDRKARAMLRSALRYMKSSLQ 107 VPAVYEEM+ SGCTPDRKARAMLRSALRY+K +++ Sbjct: 42 VPAVYEEMILSGCTPDRKARAMLRSALRYIKQAVK 76 >XP_019190034.1 PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Ipomoea nil] XP_019190037.1 PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Ipomoea nil] Length = 693 Score = 65.9 bits (159), Expect = 3e-10 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 3 VPAVYEEMLSSGCTPDRKARAMLRSALRYMKSSLQL 110 VPAVYEEML SGC PDRKARAMLRSALRYMKS+L+L Sbjct: 658 VPAVYEEMLLSGCKPDRKARAMLRSALRYMKSTLKL 693 >NP_001333499.1 pentatricopeptide repeat-containing protein [Solanum lycopersicum] Length = 699 Score = 65.9 bits (159), Expect = 3e-10 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 3 VPAVYEEMLSSGCTPDRKARAMLRSALRYMKSSLQL 110 VPAVYEEML SGC PDRKARAMLRSALRYMKS+L+L Sbjct: 664 VPAVYEEMLLSGCIPDRKARAMLRSALRYMKSTLKL 699 >XP_015085397.1 PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Solanum pennellii] Length = 700 Score = 65.9 bits (159), Expect = 3e-10 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 3 VPAVYEEMLSSGCTPDRKARAMLRSALRYMKSSLQL 110 VPAVYEEML SGC PDRKARAMLRSALRYMKS+L+L Sbjct: 665 VPAVYEEMLLSGCIPDRKARAMLRSALRYMKSTLKL 700 >XP_019240000.1 PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Nicotiana attenuata] XP_019240001.1 PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Nicotiana attenuata] OIT20569.1 pentatricopeptide repeat-containing protein, mitochondrial [Nicotiana attenuata] Length = 710 Score = 65.5 bits (158), Expect = 3e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +3 Query: 3 VPAVYEEMLSSGCTPDRKARAMLRSALRYMKSSLQ 107 VPAVYEEML SGCTPDRKARAMLRSALRY+KS+L+ Sbjct: 676 VPAVYEEMLLSGCTPDRKARAMLRSALRYLKSTLK 710 >XP_009784787.1 PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Nicotiana sylvestris] XP_009784788.1 PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Nicotiana sylvestris] XP_016466255.1 PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Nicotiana tabacum] Length = 710 Score = 65.5 bits (158), Expect = 3e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +3 Query: 3 VPAVYEEMLSSGCTPDRKARAMLRSALRYMKSSLQ 107 VPAVYEEML SGCTPDRKARAMLRSALRY+KS+L+ Sbjct: 676 VPAVYEEMLLSGCTPDRKARAMLRSALRYLKSTLK 710 >XP_009606848.1 PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Nicotiana tomentosiformis] XP_016511893.1 PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Nicotiana tabacum] Length = 710 Score = 65.5 bits (158), Expect = 3e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +3 Query: 3 VPAVYEEMLSSGCTPDRKARAMLRSALRYMKSSLQ 107 VPAVYEEML SGCTPDRKARAMLRSALRY+KS+L+ Sbjct: 676 VPAVYEEMLLSGCTPDRKARAMLRSALRYLKSTLK 710 >KYP47801.1 hypothetical protein KK1_030565 [Cajanus cajan] Length = 489 Score = 65.1 bits (157), Expect = 5e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +3 Query: 3 VPAVYEEMLSSGCTPDRKARAMLRSALRYMKSSLQ 107 VPAVYEEM++SGCTPDRKARAMLRSALRYMK +L+ Sbjct: 454 VPAVYEEMVTSGCTPDRKARAMLRSALRYMKQTLK 488 >KHN33805.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 489 Score = 65.1 bits (157), Expect = 5e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +3 Query: 3 VPAVYEEMLSSGCTPDRKARAMLRSALRYMKSSLQ 107 VPAVYEEM++SGCTPDRKARAMLRSALRYMK +L+ Sbjct: 454 VPAVYEEMVASGCTPDRKARAMLRSALRYMKQTLK 488 >KHN20117.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 613 Score = 65.1 bits (157), Expect = 5e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +3 Query: 3 VPAVYEEMLSSGCTPDRKARAMLRSALRYMKSSLQ 107 VPAVYEEM++SGCTPDRKARAMLRSALRYMK +L+ Sbjct: 578 VPAVYEEMVTSGCTPDRKARAMLRSALRYMKQTLK 612 >XP_003523110.1 PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial isoform X1 [Glycine max] XP_006577943.2 PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial isoform X1 [Glycine max] KRH60943.1 hypothetical protein GLYMA_04G018000 [Glycine max] KRH60944.1 hypothetical protein GLYMA_04G018000 [Glycine max] Length = 680 Score = 65.1 bits (157), Expect = 5e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +3 Query: 3 VPAVYEEMLSSGCTPDRKARAMLRSALRYMKSSLQ 107 VPAVYEEM++SGCTPDRKARAMLRSALRYMK +L+ Sbjct: 645 VPAVYEEMVASGCTPDRKARAMLRSALRYMKQTLK 679 >XP_003527377.1 PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Glycine max] KRH51621.1 hypothetical protein GLYMA_06G018300 [Glycine max] KRH51622.1 hypothetical protein GLYMA_06G018300 [Glycine max] Length = 696 Score = 65.1 bits (157), Expect = 5e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +3 Query: 3 VPAVYEEMLSSGCTPDRKARAMLRSALRYMKSSLQ 107 VPAVYEEM++SGCTPDRKARAMLRSALRYMK +L+ Sbjct: 661 VPAVYEEMVTSGCTPDRKARAMLRSALRYMKQTLK 695