BLASTX nr result
ID: Lithospermum23_contig00031181
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00031181 (576 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH13286.1 hypothetical protein GLYMA_15G228400 [Glycine max] 72 1e-13 XP_012575066.1 PREDICTED: uncharacterized protein LOC101494761 [... 47 7e-07 >KRH13286.1 hypothetical protein GLYMA_15G228400 [Glycine max] Length = 68 Score = 72.0 bits (175), Expect = 1e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -1 Query: 255 MISARAARRTTIVSLVTTRVELSQRVWYSSLSERASGISC 136 MISARAARRTTIVS VTTRVE SQ+VWYSSLSERASGISC Sbjct: 1 MISARAARRTTIVSPVTTRVEWSQKVWYSSLSERASGISC 40 >XP_012575066.1 PREDICTED: uncharacterized protein LOC101494761 [Cicer arietinum] Length = 420 Score = 47.4 bits (111), Expect(2) = 7e-07 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 182 GYGIAAFPSEPLGSPVNPHD 123 GYGIAAFPSEPLGSP+NPHD Sbjct: 223 GYGIAAFPSEPLGSPINPHD 242 Score = 33.1 bits (74), Expect(2) = 7e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -3 Query: 112 EDIRGSSEWRFPC 74 EDIRG+SEWRFPC Sbjct: 245 EDIRGNSEWRFPC 257