BLASTX nr result
ID: Lithospermum23_contig00031165
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00031165 (205 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019187747.1 PREDICTED: R3H domain-containing protein 2-like [... 51 8e-06 >XP_019187747.1 PREDICTED: R3H domain-containing protein 2-like [Ipomoea nil] Length = 371 Score = 51.2 bits (121), Expect = 8e-06 Identities = 30/52 (57%), Positives = 34/52 (65%), Gaps = 6/52 (11%) Frame = -1 Query: 139 MDSTLPNVSNENDVVSAEKEPLAYADVA------MVDPFLVEALQNPRHRLT 2 M+S P V +E DVV E A ADVA MVDPFL+EALQNPRHR+T Sbjct: 6 MNSRSPAVVSEKDVVLKPTENDAAADVAAPAYMSMVDPFLIEALQNPRHRVT 57