BLASTX nr result
ID: Lithospermum23_contig00031077
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00031077 (237 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KJB39789.1 hypothetical protein B456_007G034400 [Gossypium raimo... 57 3e-08 CBI15304.3 unnamed protein product, partial [Vitis vinifera] 58 4e-08 XP_002267633.1 PREDICTED: transcription factor bHLH79 [Vitis vin... 58 5e-08 CAN75381.1 hypothetical protein VITISV_027596 [Vitis vinifera] 58 5e-08 XP_012488874.1 PREDICTED: transcription factor bHLH79 isoform X2... 57 6e-08 XP_012488873.1 PREDICTED: transcription factor bHLH79 isoform X1... 57 6e-08 XP_017616404.1 PREDICTED: transcription factor bHLH79 [Gossypium... 57 6e-08 XP_006439699.1 hypothetical protein CICLE_v10021606mg [Citrus cl... 56 1e-07 XP_007099748.1 PREDICTED: transcription factor bHLH79 [Theobroma... 56 2e-07 KDO69862.1 hypothetical protein CISIN_1g023847mg [Citrus sinensis] 56 2e-07 XP_006439700.1 hypothetical protein CICLE_v10021606mg [Citrus cl... 56 2e-07 KDO69860.1 hypothetical protein CISIN_1g023847mg [Citrus sinensis] 56 2e-07 XP_006439701.1 hypothetical protein CICLE_v10021606mg [Citrus cl... 56 2e-07 XP_006476705.1 PREDICTED: transcription factor bHLH79 [Citrus si... 56 2e-07 XP_019154446.1 PREDICTED: transcription factor bHLH79-like [Ipom... 55 6e-07 XP_009369386.1 PREDICTED: transcription factor bHLH79-like [Pyru... 53 1e-06 XP_019244474.1 PREDICTED: transcription factor bHLH79-like [Nico... 52 1e-06 AOY34415.1 transcription factor BHLH044, partial [Vaccinium cory... 54 1e-06 XP_008453158.1 PREDICTED: transcription factor bHLH79 [Cucumis m... 54 1e-06 XP_016695720.1 PREDICTED: transcription factor bHLH79 isoform X2... 54 2e-06 >KJB39789.1 hypothetical protein B456_007G034400 [Gossypium raimondii] Length = 199 Score = 57.4 bits (137), Expect = 3e-08 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 104 MDPPLINEASFSVANPAAYSLAGIWPFPVS 193 MDPPLINE+SFS ANP+AYSLA IWPFP++ Sbjct: 1 MDPPLINESSFSAANPSAYSLAEIWPFPIN 30 >CBI15304.3 unnamed protein product, partial [Vitis vinifera] Length = 269 Score = 57.8 bits (138), Expect = 4e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 104 MDPPLINEASFSVANPAAYSLAGIWPFPVS 193 MDPPLINE+SFS ANP+AYSLA IWPFPV+ Sbjct: 1 MDPPLINESSFSAANPSAYSLAEIWPFPVN 30 >XP_002267633.1 PREDICTED: transcription factor bHLH79 [Vitis vinifera] Length = 284 Score = 57.8 bits (138), Expect = 5e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 104 MDPPLINEASFSVANPAAYSLAGIWPFPVS 193 MDPPLINE+SFS ANP+AYSLA IWPFPV+ Sbjct: 1 MDPPLINESSFSAANPSAYSLAEIWPFPVN 30 >CAN75381.1 hypothetical protein VITISV_027596 [Vitis vinifera] Length = 328 Score = 57.8 bits (138), Expect = 5e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 104 MDPPLINEASFSVANPAAYSLAGIWPFPVS 193 MDPPLINE+SFS ANP+AYSLA IWPFPV+ Sbjct: 1 MDPPLINESSFSAANPSAYSLAEIWPFPVN 30 >XP_012488874.1 PREDICTED: transcription factor bHLH79 isoform X2 [Gossypium raimondii] KJB39788.1 hypothetical protein B456_007G034400 [Gossypium raimondii] Length = 281 Score = 57.4 bits (137), Expect = 6e-08 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 104 MDPPLINEASFSVANPAAYSLAGIWPFPVS 193 MDPPLINE+SFS ANP+AYSLA IWPFP++ Sbjct: 1 MDPPLINESSFSAANPSAYSLAEIWPFPIN 30 >XP_012488873.1 PREDICTED: transcription factor bHLH79 isoform X1 [Gossypium raimondii] KJB39787.1 hypothetical protein B456_007G034400 [Gossypium raimondii] Length = 285 Score = 57.4 bits (137), Expect = 6e-08 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 104 MDPPLINEASFSVANPAAYSLAGIWPFPVS 193 MDPPLINE+SFS ANP+AYSLA IWPFP++ Sbjct: 1 MDPPLINESSFSAANPSAYSLAEIWPFPIN 30 >XP_017616404.1 PREDICTED: transcription factor bHLH79 [Gossypium arboreum] KHG29675.1 Transcription factor bHLH79 -like protein [Gossypium arboreum] Length = 285 Score = 57.4 bits (137), Expect = 6e-08 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 104 MDPPLINEASFSVANPAAYSLAGIWPFPVS 193 MDPPLINE+SFS ANP+AYSLA IWPFP++ Sbjct: 1 MDPPLINESSFSAANPSAYSLAEIWPFPIN 30 >XP_006439699.1 hypothetical protein CICLE_v10021606mg [Citrus clementina] ESR52939.1 hypothetical protein CICLE_v10021606mg [Citrus clementina] Length = 182 Score = 55.8 bits (133), Expect = 1e-07 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +2 Query: 104 MDPPLINEASFSVANPAAYSLAGIWPFPVS 193 MDPPL+NE+SFS ANP++YSLA IWPFP++ Sbjct: 1 MDPPLVNESSFSAANPSSYSLAEIWPFPIN 30 >XP_007099748.1 PREDICTED: transcription factor bHLH79 [Theobroma cacao] EOY20293.1 Basic helix-loop-helix DNA-binding superfamily protein [Theobroma cacao] Length = 283 Score = 56.2 bits (134), Expect = 2e-07 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = +2 Query: 104 MDPPLINEASFSVANPAAYSLAGIWPFPVS 193 MDPPLINE+SFS ANP++YSLA IWPFP++ Sbjct: 1 MDPPLINESSFSAANPSSYSLAEIWPFPIN 30 >KDO69862.1 hypothetical protein CISIN_1g023847mg [Citrus sinensis] Length = 239 Score = 55.8 bits (133), Expect = 2e-07 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +2 Query: 104 MDPPLINEASFSVANPAAYSLAGIWPFPVS 193 MDPPL+NE+SFS ANP++YSLA IWPFP++ Sbjct: 1 MDPPLVNESSFSAANPSSYSLAEIWPFPIN 30 >XP_006439700.1 hypothetical protein CICLE_v10021606mg [Citrus clementina] ESR52940.1 hypothetical protein CICLE_v10021606mg [Citrus clementina] Length = 239 Score = 55.8 bits (133), Expect = 2e-07 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +2 Query: 104 MDPPLINEASFSVANPAAYSLAGIWPFPVS 193 MDPPL+NE+SFS ANP++YSLA IWPFP++ Sbjct: 1 MDPPLVNESSFSAANPSSYSLAEIWPFPIN 30 >KDO69860.1 hypothetical protein CISIN_1g023847mg [Citrus sinensis] Length = 276 Score = 55.8 bits (133), Expect = 2e-07 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +2 Query: 104 MDPPLINEASFSVANPAAYSLAGIWPFPVS 193 MDPPL+NE+SFS ANP++YSLA IWPFP++ Sbjct: 1 MDPPLVNESSFSAANPSSYSLAEIWPFPIN 30 >XP_006439701.1 hypothetical protein CICLE_v10021606mg [Citrus clementina] ESR52941.1 hypothetical protein CICLE_v10021606mg [Citrus clementina] Length = 276 Score = 55.8 bits (133), Expect = 2e-07 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +2 Query: 104 MDPPLINEASFSVANPAAYSLAGIWPFPVS 193 MDPPL+NE+SFS ANP++YSLA IWPFP++ Sbjct: 1 MDPPLVNESSFSAANPSSYSLAEIWPFPIN 30 >XP_006476705.1 PREDICTED: transcription factor bHLH79 [Citrus sinensis] Length = 278 Score = 55.8 bits (133), Expect = 2e-07 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +2 Query: 104 MDPPLINEASFSVANPAAYSLAGIWPFPVS 193 MDPPL+NE+SFS ANP++YSLA IWPFP++ Sbjct: 1 MDPPLVNESSFSAANPSSYSLAEIWPFPIN 30 >XP_019154446.1 PREDICTED: transcription factor bHLH79-like [Ipomoea nil] Length = 280 Score = 54.7 bits (130), Expect = 6e-07 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +2 Query: 104 MDPPLINEASFSVANPAAYSLAGIWPF 184 MDPP+INEASFS ANPAAYSLA IWPF Sbjct: 1 MDPPIINEASFSAANPAAYSLAEIWPF 27 >XP_009369386.1 PREDICTED: transcription factor bHLH79-like [Pyrus x bretschneideri] Length = 180 Score = 53.1 bits (126), Expect = 1e-06 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = +2 Query: 104 MDPPLINEASFSVANPAAYSLAGIWPF 184 MDPPLINE+SFS ANPA+YSLA IWPF Sbjct: 8 MDPPLINESSFSAANPASYSLAEIWPF 34 >XP_019244474.1 PREDICTED: transcription factor bHLH79-like [Nicotiana attenuata] Length = 145 Score = 52.4 bits (124), Expect = 1e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +2 Query: 104 MDPPLINEASFSVANPAAYSLAGIWPF 184 MDPP+INEASFS ANP++YSLA IWPF Sbjct: 1 MDPPIINEASFSAANPSSYSLAEIWPF 27 >AOY34415.1 transcription factor BHLH044, partial [Vaccinium corymbosum] Length = 273 Score = 53.5 bits (127), Expect = 1e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +2 Query: 104 MDPPLINEASFSVANPAAYSLAGIWPFPVS 193 MDPPLINEASFS ANP++YSLA IWPF ++ Sbjct: 1 MDPPLINEASFSAANPSSYSLAEIWPFQMN 30 >XP_008453158.1 PREDICTED: transcription factor bHLH79 [Cucumis melo] Length = 276 Score = 53.5 bits (127), Expect = 1e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +2 Query: 104 MDPPLINEASFSVANPAAYSLAGIWPF 184 MDPPL+NE+SFS ANP+AYSLA IWPF Sbjct: 1 MDPPLVNESSFSAANPSAYSLASIWPF 27 >XP_016695720.1 PREDICTED: transcription factor bHLH79 isoform X2 [Gossypium hirsutum] Length = 281 Score = 53.5 bits (127), Expect = 2e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +2 Query: 104 MDPPLINEASFSVANPAAYSLAGIWPFPVS 193 MDPPLINE+SFS ANP+AYSLA IWPF ++ Sbjct: 1 MDPPLINESSFSAANPSAYSLAEIWPFLIN 30