BLASTX nr result
ID: Lithospermum23_contig00030955
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00030955 (568 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019167749.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 [Ipo... 101 1e-21 KVH90417.1 Zinc finger, RING/FYVE/PHD-type [Cynara cardunculus v... 98 5e-21 XP_009802066.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 isof... 99 7e-21 XP_009802065.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 isof... 99 7e-21 EPS57387.1 hypothetical protein M569_17431, partial [Genlisea au... 92 2e-20 XP_016469048.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 isof... 98 2e-20 XP_017237702.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3-like... 98 2e-20 XP_015970232.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 isof... 97 2e-20 XP_016469047.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 isof... 98 2e-20 XP_016469046.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 isof... 98 2e-20 XP_018629352.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 [Nic... 98 2e-20 XP_019250735.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 [Nic... 98 2e-20 XP_015970231.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 isof... 97 5e-20 XP_016207757.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 [Ara... 97 6e-20 XP_016542806.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 isof... 96 1e-19 XP_004494071.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 [Cic... 95 3e-19 XP_017409928.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 isof... 94 4e-19 BAT85747.1 hypothetical protein VIGAN_04332800 [Vigna angularis ... 94 4e-19 XP_016542805.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 isof... 94 4e-19 KZN00554.1 hypothetical protein DCAR_009308 [Daucus carota subsp... 94 6e-19 >XP_019167749.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 [Ipomoea nil] Length = 638 Score = 101 bits (252), Expect = 1e-21 Identities = 41/52 (78%), Positives = 48/52 (92%) Frame = -2 Query: 156 EEVSSSHLDGLFCPICMEPWTSGGDHQICCLPCGHIYGLSCIKKWLRQRKAS 1 EE S S +DGLFCPICME W++GG+HQICCLPCGHIYG+SCIKKWL+QRK+S Sbjct: 128 EEWSRSDIDGLFCPICMEAWSNGGNHQICCLPCGHIYGISCIKKWLQQRKSS 179 >KVH90417.1 Zinc finger, RING/FYVE/PHD-type [Cynara cardunculus var. scolymus] Length = 357 Score = 98.2 bits (243), Expect = 5e-21 Identities = 39/51 (76%), Positives = 44/51 (86%) Frame = -2 Query: 153 EVSSSHLDGLFCPICMEPWTSGGDHQICCLPCGHIYGLSCIKKWLRQRKAS 1 E + +DGLFCPIC E WTSGGDHQICCLPCGHIYG SCIKKWL+QR++S Sbjct: 187 EFNRGEIDGLFCPICFEAWTSGGDHQICCLPCGHIYGSSCIKKWLQQRRSS 237 >XP_009802066.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 isoform X2 [Nicotiana sylvestris] Length = 644 Score = 99.4 bits (246), Expect = 7e-21 Identities = 43/65 (66%), Positives = 50/65 (76%), Gaps = 8/65 (12%) Frame = -2 Query: 180 AERDIDDEE--------EVSSSHLDGLFCPICMEPWTSGGDHQICCLPCGHIYGLSCIKK 25 A +D+D EE E + S +DGLFCPICME WT+ GDHQICCLPCGHIYGLSCIKK Sbjct: 128 ASQDVDKEEGDGGEAEGEWNRSEIDGLFCPICMEAWTNDGDHQICCLPCGHIYGLSCIKK 187 Query: 24 WLRQR 10 WL+Q+ Sbjct: 188 WLQQK 192 >XP_009802065.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 isoform X1 [Nicotiana sylvestris] Length = 652 Score = 99.4 bits (246), Expect = 7e-21 Identities = 43/65 (66%), Positives = 50/65 (76%), Gaps = 8/65 (12%) Frame = -2 Query: 180 AERDIDDEE--------EVSSSHLDGLFCPICMEPWTSGGDHQICCLPCGHIYGLSCIKK 25 A +D+D EE E + S +DGLFCPICME WT+ GDHQICCLPCGHIYGLSCIKK Sbjct: 128 ASQDVDKEEGDGGEAEGEWNRSEIDGLFCPICMEAWTNDGDHQICCLPCGHIYGLSCIKK 187 Query: 24 WLRQR 10 WL+Q+ Sbjct: 188 WLQQK 192 >EPS57387.1 hypothetical protein M569_17431, partial [Genlisea aurea] Length = 155 Score = 92.4 bits (228), Expect = 2e-20 Identities = 35/52 (67%), Positives = 44/52 (84%) Frame = -2 Query: 165 DDEEEVSSSHLDGLFCPICMEPWTSGGDHQICCLPCGHIYGLSCIKKWLRQR 10 +D +V +DGLFCPIC+E W+SGG+HQ+CCLPCGHIYGLSCIKKWL ++ Sbjct: 70 NDGGQVDRDEVDGLFCPICLEAWSSGGEHQVCCLPCGHIYGLSCIKKWLSRQ 121 >XP_016469048.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 isoform X3 [Nicotiana tabacum] Length = 494 Score = 97.8 bits (242), Expect = 2e-20 Identities = 42/65 (64%), Positives = 50/65 (76%), Gaps = 8/65 (12%) Frame = -2 Query: 180 AERDIDDEE--------EVSSSHLDGLFCPICMEPWTSGGDHQICCLPCGHIYGLSCIKK 25 A +D+D EE E + S ++GLFCPICME WT+ GDHQICCLPCGHIYGLSCIKK Sbjct: 130 ASQDVDKEEDGGGEGEGEWNRSEIEGLFCPICMEAWTNDGDHQICCLPCGHIYGLSCIKK 189 Query: 24 WLRQR 10 WL+Q+ Sbjct: 190 WLQQK 194 >XP_017237702.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3-like [Daucus carota subsp. sativus] Length = 598 Score = 97.8 bits (242), Expect = 2e-20 Identities = 44/81 (54%), Positives = 58/81 (71%), Gaps = 7/81 (8%) Frame = -2 Query: 222 NEQIKSKMSLKSSAAERDIDDE----EEVSS---SHLDGLFCPICMEPWTSGGDHQICCL 64 +E + + +K+ IDD+ EE+ S + +DGL CPICMEPWTS G HQ+CCL Sbjct: 52 DEAVSTAAIVKNKTTPLSIDDDGSGIEELMSKDNNEIDGLCCPICMEPWTSEGVHQVCCL 111 Query: 63 PCGHIYGLSCIKKWLRQRKAS 1 PCGHIYGLSCI+KW+RQR++S Sbjct: 112 PCGHIYGLSCIQKWIRQRQSS 132 >XP_015970232.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 isoform X2 [Arachis duranensis] Length = 385 Score = 96.7 bits (239), Expect = 2e-20 Identities = 39/63 (61%), Positives = 50/63 (79%) Frame = -2 Query: 189 SSAAERDIDDEEEVSSSHLDGLFCPICMEPWTSGGDHQICCLPCGHIYGLSCIKKWLRQR 10 SS+ D E + + +DGLFCPICME WT+ GDHQICCLPCGHIYG+SCIK+WL+QR Sbjct: 107 SSSLAIDGSQGSEWNRTDIDGLFCPICMEAWTNSGDHQICCLPCGHIYGMSCIKRWLQQR 166 Query: 9 KAS 1 +++ Sbjct: 167 RST 169 >XP_016469047.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 isoform X2 [Nicotiana tabacum] Length = 646 Score = 97.8 bits (242), Expect = 2e-20 Identities = 42/65 (64%), Positives = 50/65 (76%), Gaps = 8/65 (12%) Frame = -2 Query: 180 AERDIDDEE--------EVSSSHLDGLFCPICMEPWTSGGDHQICCLPCGHIYGLSCIKK 25 A +D+D EE E + S ++GLFCPICME WT+ GDHQICCLPCGHIYGLSCIKK Sbjct: 130 ASQDVDKEEDGGGEGEGEWNRSEIEGLFCPICMEAWTNDGDHQICCLPCGHIYGLSCIKK 189 Query: 24 WLRQR 10 WL+Q+ Sbjct: 190 WLQQK 194 >XP_016469046.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 isoform X1 [Nicotiana tabacum] Length = 654 Score = 97.8 bits (242), Expect = 2e-20 Identities = 42/65 (64%), Positives = 50/65 (76%), Gaps = 8/65 (12%) Frame = -2 Query: 180 AERDIDDEE--------EVSSSHLDGLFCPICMEPWTSGGDHQICCLPCGHIYGLSCIKK 25 A +D+D EE E + S ++GLFCPICME WT+ GDHQICCLPCGHIYGLSCIKK Sbjct: 130 ASQDVDKEEDGGGEGEGEWNRSEIEGLFCPICMEAWTNDGDHQICCLPCGHIYGLSCIKK 189 Query: 24 WLRQR 10 WL+Q+ Sbjct: 190 WLQQK 194 >XP_018629352.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 [Nicotiana tomentosiformis] Length = 655 Score = 97.8 bits (242), Expect = 2e-20 Identities = 42/65 (64%), Positives = 50/65 (76%), Gaps = 8/65 (12%) Frame = -2 Query: 180 AERDIDDEE--------EVSSSHLDGLFCPICMEPWTSGGDHQICCLPCGHIYGLSCIKK 25 A +D+D EE E + S ++GLFCPICME WT+ GDHQICCLPCGHIYGLSCIKK Sbjct: 131 ASQDVDKEEDGGGEGEGEWNRSEIEGLFCPICMEAWTNDGDHQICCLPCGHIYGLSCIKK 190 Query: 24 WLRQR 10 WL+Q+ Sbjct: 191 WLQQK 195 >XP_019250735.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 [Nicotiana attenuata] XP_019250737.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 [Nicotiana attenuata] OIT01385.1 hypothetical protein A4A49_02129 [Nicotiana attenuata] Length = 657 Score = 97.8 bits (242), Expect = 2e-20 Identities = 42/65 (64%), Positives = 50/65 (76%), Gaps = 8/65 (12%) Frame = -2 Query: 180 AERDIDDEE--------EVSSSHLDGLFCPICMEPWTSGGDHQICCLPCGHIYGLSCIKK 25 A +D+D EE E + S ++GLFCPICME WT+ GDHQICCLPCGHIYGLSCIKK Sbjct: 133 ASQDVDKEEGDGGEVEGEWNRSEIEGLFCPICMEAWTNDGDHQICCLPCGHIYGLSCIKK 192 Query: 24 WLRQR 10 WL+Q+ Sbjct: 193 WLQQK 197 >XP_015970231.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 isoform X1 [Arachis duranensis] Length = 498 Score = 96.7 bits (239), Expect = 5e-20 Identities = 39/63 (61%), Positives = 50/63 (79%) Frame = -2 Query: 189 SSAAERDIDDEEEVSSSHLDGLFCPICMEPWTSGGDHQICCLPCGHIYGLSCIKKWLRQR 10 SS+ D E + + +DGLFCPICME WT+ GDHQICCLPCGHIYG+SCIK+WL+QR Sbjct: 107 SSSLAIDGSQGSEWNRTDIDGLFCPICMEAWTNSGDHQICCLPCGHIYGMSCIKRWLQQR 166 Query: 9 KAS 1 +++ Sbjct: 167 RST 169 >XP_016207757.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 [Arachis ipaensis] Length = 622 Score = 96.7 bits (239), Expect = 6e-20 Identities = 39/63 (61%), Positives = 50/63 (79%) Frame = -2 Query: 189 SSAAERDIDDEEEVSSSHLDGLFCPICMEPWTSGGDHQICCLPCGHIYGLSCIKKWLRQR 10 SS+ D E + + +DGLFCPICME WT+ GDHQICCLPCGHIYG+SCIK+WL+QR Sbjct: 103 SSSLAIDGSQGSEWNRTDIDGLFCPICMEAWTNSGDHQICCLPCGHIYGMSCIKRWLQQR 162 Query: 9 KAS 1 +++ Sbjct: 163 RST 165 >XP_016542806.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 isoform X2 [Capsicum annuum] Length = 646 Score = 95.9 bits (237), Expect = 1e-19 Identities = 39/55 (70%), Positives = 46/55 (83%) Frame = -2 Query: 165 DDEEEVSSSHLDGLFCPICMEPWTSGGDHQICCLPCGHIYGLSCIKKWLRQRKAS 1 D+ EE + S +DGLFC ICME WT+ GDHQICCLPCGH+YGLSCIKKWL Q+ +S Sbjct: 136 DEGEEWNRSEIDGLFCTICMEAWTNDGDHQICCLPCGHLYGLSCIKKWLLQKGSS 190 >XP_004494071.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 [Cicer arietinum] Length = 660 Score = 94.7 bits (234), Expect = 3e-19 Identities = 41/69 (59%), Positives = 50/69 (72%) Frame = -2 Query: 207 SKMSLKSSAAERDIDDEEEVSSSHLDGLFCPICMEPWTSGGDHQICCLPCGHIYGLSCIK 28 S SL + +A D E E + + +DGL CPICM+ WT GDH +CCLPCGHIYG+SCIK Sbjct: 127 SSSSLPNGSA--DGSQENECNLADIDGLICPICMDAWTDKGDHHVCCLPCGHIYGMSCIK 184 Query: 27 KWLRQRKAS 1 KWL+QRK S Sbjct: 185 KWLQQRKNS 193 >XP_017409928.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 isoform X1 [Vigna angularis] XP_017409929.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 isoform X2 [Vigna angularis] Length = 625 Score = 94.4 bits (233), Expect = 4e-19 Identities = 37/62 (59%), Positives = 49/62 (79%) Frame = -2 Query: 186 SAAERDIDDEEEVSSSHLDGLFCPICMEPWTSGGDHQICCLPCGHIYGLSCIKKWLRQRK 7 S A + +E +++DGLFCPICM+ WT+ G+H ICCLPCGHIYG+SCIK+WL+QRK Sbjct: 98 SFATGSSNGSQESDHTNIDGLFCPICMDVWTNNGEHHICCLPCGHIYGMSCIKRWLQQRK 157 Query: 6 AS 1 +S Sbjct: 158 SS 159 >BAT85747.1 hypothetical protein VIGAN_04332800 [Vigna angularis var. angularis] Length = 626 Score = 94.4 bits (233), Expect = 4e-19 Identities = 37/62 (59%), Positives = 49/62 (79%) Frame = -2 Query: 186 SAAERDIDDEEEVSSSHLDGLFCPICMEPWTSGGDHQICCLPCGHIYGLSCIKKWLRQRK 7 S A + +E +++DGLFCPICM+ WT+ G+H ICCLPCGHIYG+SCIK+WL+QRK Sbjct: 98 SFATGSSNGSQESDHTNIDGLFCPICMDVWTNNGEHHICCLPCGHIYGMSCIKRWLQQRK 157 Query: 6 AS 1 +S Sbjct: 158 SS 159 >XP_016542805.1 PREDICTED: E3 ubiquitin-protein ligase RFWD3 isoform X1 [Capsicum annuum] Length = 671 Score = 94.4 bits (233), Expect = 4e-19 Identities = 44/80 (55%), Positives = 54/80 (67%), Gaps = 9/80 (11%) Frame = -2 Query: 213 IKSKMSLKSSA-AERDIDDEEEVSS--------SHLDGLFCPICMEPWTSGGDHQICCLP 61 + ++ S K A RD+D EE+ S S +DGLFC ICME WT+ DHQICCLP Sbjct: 136 VATRRSFKGGGKAVRDVDKEEDGGSEGGKEWNPSEIDGLFCSICMEAWTNENDHQICCLP 195 Query: 60 CGHIYGLSCIKKWLRQRKAS 1 CGH+YGLSCIKKWL Q+ +S Sbjct: 196 CGHLYGLSCIKKWLLQKGSS 215 >KZN00554.1 hypothetical protein DCAR_009308 [Daucus carota subsp. sativus] Length = 512 Score = 93.6 bits (231), Expect = 6e-19 Identities = 36/48 (75%), Positives = 44/48 (91%) Frame = -2 Query: 144 SSHLDGLFCPICMEPWTSGGDHQICCLPCGHIYGLSCIKKWLRQRKAS 1 ++ +DGL CPICMEPWTS G HQ+CCLPCGHIYGLSCI+KW+RQR++S Sbjct: 5 NNEIDGLCCPICMEPWTSEGVHQVCCLPCGHIYGLSCIQKWIRQRQSS 52