BLASTX nr result
ID: Lithospermum23_contig00030669
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00030669 (285 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019261943.1 PREDICTED: uncharacterized protein LOC109239798 [... 52 9e-06 >XP_019261943.1 PREDICTED: uncharacterized protein LOC109239798 [Nicotiana attenuata] Length = 250 Score = 52.0 bits (123), Expect = 9e-06 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 14/63 (22%) Frame = +2 Query: 137 MATEVSSLVRLMNGRD---------SSQVVVGGGKSTDVLVTRDLLGG-----AKELDLD 274 MA EVSSLVR+MNG D SS GGKST VL+T+DLLGG +KELDLD Sbjct: 1 MAAEVSSLVRIMNGDDSYNMNESSSSSSSSRSGGKST-VLITQDLLGGCSTLDSKELDLD 59 Query: 275 LHV 283 L V Sbjct: 60 LQV 62