BLASTX nr result
ID: Lithospermum23_contig00030582
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00030582 (313 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAP47503.1 O-acetylserine (thiol)lyase [Gentiana triflora] 60 1e-08 XP_010024285.1 PREDICTED: cysteine synthase [Eucalyptus grandis]... 60 2e-08 XP_016507134.1 PREDICTED: cysteine synthase-like [Nicotiana taba... 59 2e-08 XP_015875490.1 PREDICTED: cysteine synthase-like isoform X3 [Ziz... 59 3e-08 OIS96228.1 cysteine synthase [Nicotiana attenuata] 59 3e-08 XP_015875485.1 PREDICTED: cysteine synthase-like isoform X2 [Ziz... 59 4e-08 XP_010550162.1 PREDICTED: cysteine synthase isoform X1 [Tarenaya... 59 4e-08 XP_015875484.1 PREDICTED: cysteine synthase-like isoform X1 [Ziz... 59 4e-08 OMO80746.1 Tryptophan synthase beta subunit-like PLP-dependent e... 57 4e-08 KVH88514.1 Cysteine synthase A [Cynara cardunculus var. scolymus] 59 4e-08 KHG27681.1 Cysteine synthase [Gossypium arboreum] 59 4e-08 XP_017607765.1 PREDICTED: cysteine synthase isoform X1 [Gossypiu... 59 5e-08 XP_015888186.1 PREDICTED: cysteine synthase [Ziziphus jujuba] XP... 59 5e-08 XP_012487166.1 PREDICTED: cysteine synthase [Gossypium raimondii... 59 5e-08 XP_016715322.1 PREDICTED: cysteine synthase [Gossypium hirsutum] 59 5e-08 XP_011071587.1 PREDICTED: cysteine synthase [Sesamum indicum] XP... 58 9e-08 XP_010090922.1 Cysteine synthase [Morus notabilis] EXB41294.1 Cy... 58 1e-07 XP_019427530.1 PREDICTED: cysteine synthase-like [Lupinus angust... 57 2e-07 XP_018842448.1 PREDICTED: cysteine synthase [Juglans regia] XP_0... 57 2e-07 XP_009369846.1 PREDICTED: cysteine synthase-like [Pyrus x bretsc... 57 2e-07 >BAP47503.1 O-acetylserine (thiol)lyase [Gentiana triflora] Length = 325 Score = 60.5 bits (145), Expect = 1e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 3 VVIFPSFGERYLSSALFDSVRKEAENMTFDP 95 V IFPSFGERYLSS LF+SVRKEAENMTFDP Sbjct: 295 VTIFPSFGERYLSSVLFESVRKEAENMTFDP 325 >XP_010024285.1 PREDICTED: cysteine synthase [Eucalyptus grandis] XP_010024286.1 PREDICTED: cysteine synthase [Eucalyptus grandis] XP_010024287.1 PREDICTED: cysteine synthase [Eucalyptus grandis] XP_010024288.1 PREDICTED: cysteine synthase [Eucalyptus grandis] KCW60734.1 hypothetical protein EUGRSUZ_H03464 [Eucalyptus grandis] Length = 325 Score = 60.1 bits (144), Expect = 2e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 3 VVIFPSFGERYLSSALFDSVRKEAENMTFDP 95 VV+FPSFGERYLSS LF+SVRKEAENMTF+P Sbjct: 295 VVVFPSFGERYLSSVLFESVRKEAENMTFEP 325 >XP_016507134.1 PREDICTED: cysteine synthase-like [Nicotiana tabacum] Length = 238 Score = 59.3 bits (142), Expect = 2e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 3 VVIFPSFGERYLSSALFDSVRKEAENMTFDP 95 VVIFPSFGERYLSS LF+SVR+EAENMTF+P Sbjct: 208 VVIFPSFGERYLSSVLFESVRREAENMTFEP 238 >XP_015875490.1 PREDICTED: cysteine synthase-like isoform X3 [Ziziphus jujuba] Length = 284 Score = 59.3 bits (142), Expect = 3e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 VVIFPSFGERYLSSALFDSVRKEAENMTFD 92 VV+FPSFGERYLSSALFDS+R EAENMTFD Sbjct: 255 VVVFPSFGERYLSSALFDSIRHEAENMTFD 284 >OIS96228.1 cysteine synthase [Nicotiana attenuata] Length = 286 Score = 59.3 bits (142), Expect = 3e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 3 VVIFPSFGERYLSSALFDSVRKEAENMTFDP 95 VVIFPSFGERYLSS LF+SVR+EAENMTF+P Sbjct: 256 VVIFPSFGERYLSSVLFESVRREAENMTFEP 286 >XP_015875485.1 PREDICTED: cysteine synthase-like isoform X2 [Ziziphus jujuba] XP_015875486.1 PREDICTED: cysteine synthase-like isoform X2 [Ziziphus jujuba] XP_015875488.1 PREDICTED: cysteine synthase-like isoform X2 [Ziziphus jujuba] XP_015875489.1 PREDICTED: cysteine synthase-like isoform X2 [Ziziphus jujuba] Length = 323 Score = 59.3 bits (142), Expect = 4e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 VVIFPSFGERYLSSALFDSVRKEAENMTFD 92 VV+FPSFGERYLSSALFDS+R EAENMTFD Sbjct: 294 VVVFPSFGERYLSSALFDSIRHEAENMTFD 323 >XP_010550162.1 PREDICTED: cysteine synthase isoform X1 [Tarenaya hassleriana] XP_010550171.1 PREDICTED: cysteine synthase isoform X1 [Tarenaya hassleriana] Length = 325 Score = 59.3 bits (142), Expect = 4e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 3 VVIFPSFGERYLSSALFDSVRKEAENMTFDP 95 VV+FPSFGERYLSS LFDSVRKEAE MTF+P Sbjct: 295 VVVFPSFGERYLSSVLFDSVRKEAETMTFEP 325 >XP_015875484.1 PREDICTED: cysteine synthase-like isoform X1 [Ziziphus jujuba] Length = 331 Score = 59.3 bits (142), Expect = 4e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 VVIFPSFGERYLSSALFDSVRKEAENMTFD 92 VV+FPSFGERYLSSALFDS+R EAENMTFD Sbjct: 302 VVVFPSFGERYLSSALFDSIRHEAENMTFD 331 >OMO80746.1 Tryptophan synthase beta subunit-like PLP-dependent enzymes superfamily [Corchorus capsularis] Length = 132 Score = 57.0 bits (136), Expect = 4e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 3 VVIFPSFGERYLSSALFDSVRKEAENMTFDP 95 V IFPSFGERYLSS LF+SVRKEAE+MTF+P Sbjct: 102 VAIFPSFGERYLSSVLFESVRKEAESMTFEP 132 >KVH88514.1 Cysteine synthase A [Cynara cardunculus var. scolymus] Length = 368 Score = 59.3 bits (142), Expect = 4e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 3 VVIFPSFGERYLSSALFDSVRKEAENMTFDP 95 VVIFPSFGERYLSS LF+SVR+EAENMTF+P Sbjct: 338 VVIFPSFGERYLSSVLFESVRREAENMTFEP 368 >KHG27681.1 Cysteine synthase [Gossypium arboreum] Length = 297 Score = 58.9 bits (141), Expect = 4e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 3 VVIFPSFGERYLSSALFDSVRKEAENMTFDP 95 V IFPSFGERYLSS LF+SVRKEAENMTF+P Sbjct: 267 VAIFPSFGERYLSSVLFESVRKEAENMTFEP 297 >XP_017607765.1 PREDICTED: cysteine synthase isoform X1 [Gossypium arboreum] Length = 325 Score = 58.9 bits (141), Expect = 5e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 3 VVIFPSFGERYLSSALFDSVRKEAENMTFDP 95 V IFPSFGERYLSS LF+SVRKEAENMTF+P Sbjct: 295 VAIFPSFGERYLSSVLFESVRKEAENMTFEP 325 >XP_015888186.1 PREDICTED: cysteine synthase [Ziziphus jujuba] XP_015888187.1 PREDICTED: cysteine synthase [Ziziphus jujuba] XP_015888188.1 PREDICTED: cysteine synthase [Ziziphus jujuba] XP_015888189.1 PREDICTED: cysteine synthase [Ziziphus jujuba] Length = 325 Score = 58.9 bits (141), Expect = 5e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 3 VVIFPSFGERYLSSALFDSVRKEAENMTFDP 95 VV+FPSFGERYLSS LF+SVR+EAENMTF+P Sbjct: 295 VVVFPSFGERYLSSVLFESVRREAENMTFEP 325 >XP_012487166.1 PREDICTED: cysteine synthase [Gossypium raimondii] KJB38153.1 hypothetical protein B456_006G239500 [Gossypium raimondii] Length = 325 Score = 58.9 bits (141), Expect = 5e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 3 VVIFPSFGERYLSSALFDSVRKEAENMTFDP 95 V IFPSFGERYLSS LF+SVRKEAENMTF+P Sbjct: 295 VAIFPSFGERYLSSVLFESVRKEAENMTFEP 325 >XP_016715322.1 PREDICTED: cysteine synthase [Gossypium hirsutum] Length = 382 Score = 58.9 bits (141), Expect = 5e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 3 VVIFPSFGERYLSSALFDSVRKEAENMTFDP 95 V IFPSFGERYLSS LF+SVRKEAENMTF+P Sbjct: 352 VAIFPSFGERYLSSVLFESVRKEAENMTFEP 382 >XP_011071587.1 PREDICTED: cysteine synthase [Sesamum indicum] XP_011071588.1 PREDICTED: cysteine synthase [Sesamum indicum] Length = 325 Score = 58.2 bits (139), Expect = 9e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 3 VVIFPSFGERYLSSALFDSVRKEAENMTFDP 95 VV+FPSFGERYLSS LF+SVRKEAE+MTF+P Sbjct: 295 VVVFPSFGERYLSSVLFESVRKEAESMTFEP 325 >XP_010090922.1 Cysteine synthase [Morus notabilis] EXB41294.1 Cysteine synthase [Morus notabilis] Length = 325 Score = 57.8 bits (138), Expect = 1e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 3 VVIFPSFGERYLSSALFDSVRKEAENMTFDP 95 VVIF SFGERYLSS LFDSV+KEAENMTF+P Sbjct: 295 VVIFASFGERYLSSVLFDSVKKEAENMTFEP 325 >XP_019427530.1 PREDICTED: cysteine synthase-like [Lupinus angustifolius] XP_019427531.1 PREDICTED: cysteine synthase-like [Lupinus angustifolius] OIV91500.1 hypothetical protein TanjilG_26469 [Lupinus angustifolius] Length = 325 Score = 57.4 bits (137), Expect = 2e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 3 VVIFPSFGERYLSSALFDSVRKEAENMTFDP 95 V +FPSFGERYLSS LF+SVRKEAEN+TF+P Sbjct: 295 VAVFPSFGERYLSSVLFESVRKEAENLTFEP 325 >XP_018842448.1 PREDICTED: cysteine synthase [Juglans regia] XP_018842449.1 PREDICTED: cysteine synthase [Juglans regia] Length = 325 Score = 57.4 bits (137), Expect = 2e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 3 VVIFPSFGERYLSSALFDSVRKEAENMTFDP 95 VVIFPSFGERYLSS LF+SVR+EAE+MTF+P Sbjct: 295 VVIFPSFGERYLSSVLFESVRREAESMTFEP 325 >XP_009369846.1 PREDICTED: cysteine synthase-like [Pyrus x bretschneideri] Length = 325 Score = 57.4 bits (137), Expect = 2e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 3 VVIFPSFGERYLSSALFDSVRKEAENMTFDP 95 VVIFPSFGERYLSS LF+SVR+EAE+MTF+P Sbjct: 295 VVIFPSFGERYLSSVLFESVRREAESMTFEP 325