BLASTX nr result
ID: Lithospermum23_contig00030213
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00030213 (586 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIV96983.1 hypothetical protein TanjilG_31874 [Lupinus angustifo... 60 1e-08 XP_006382826.1 hypothetical protein POPTR_0005s05820g [Populus t... 60 2e-08 XP_019416077.1 PREDICTED: UPF0235 protein C15orf40 homolog [Lupi... 60 2e-08 NP_001238533.1 uncharacterized protein LOC100499954 [Glycine max... 60 2e-08 XP_019177259.1 PREDICTED: UPF0235 protein C15orf40 homolog [Ipom... 60 2e-08 XP_003602559.1 UPF0235 C15orf40-like protein [Medicago truncatul... 60 3e-08 NP_001237633.1 uncharacterized protein LOC100527290 [Glycine max... 60 3e-08 GAV62780.1 DUF167 domain-containing protein, partial [Cephalotus... 60 3e-08 XP_014629822.1 PREDICTED: uncharacterized protein LOC100527290 i... 60 3e-08 ACU17552.1 unknown, partial [Glycine max] 58 4e-08 GAU13192.1 hypothetical protein TSUD_179350 [Trifolium subterran... 59 4e-08 XP_004502908.1 PREDICTED: UPF0235 protein C15orf40 homolog [Cice... 59 5e-08 KRH64085.1 hypothetical protein GLYMA_04G215300 [Glycine max] 58 6e-08 KDO40384.1 hypothetical protein CISIN_1g033057mg [Citrus sinensis] 58 7e-08 KDO40385.1 hypothetical protein CISIN_1g033057mg [Citrus sinensis] 58 7e-08 XP_011032559.1 PREDICTED: uncharacterized protein LOC105131332 [... 61 8e-08 KDO40383.1 hypothetical protein CISIN_1g033057mg [Citrus sinensis] 58 8e-08 XP_007048278.2 PREDICTED: UPF0235 protein C15orf40 homolog [Theo... 59 8e-08 XP_016542769.1 PREDICTED: UPF0235 protein C15orf40 homolog [Caps... 59 8e-08 KYP69410.1 UPF0235 protein C15orf40 isogeny [Cajanus cajan] 59 8e-08 >OIV96983.1 hypothetical protein TanjilG_31874 [Lupinus angustifolius] Length = 99 Score = 60.1 bits (144), Expect = 1e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +3 Query: 486 NLVDISDEAVGVQIDAPAKDGEANAALIDYISS 584 ++ DISDEAVGVQIDAPA+DGEANAAL+DYISS Sbjct: 51 SITDISDEAVGVQIDAPARDGEANAALLDYISS 83 >XP_006382826.1 hypothetical protein POPTR_0005s05820g [Populus trichocarpa] ERP60623.1 hypothetical protein POPTR_0005s05820g [Populus trichocarpa] Length = 131 Score = 60.5 bits (145), Expect = 2e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +3 Query: 486 NLVDISDEAVGVQIDAPAKDGEANAALIDYISS 584 ++ D+SDEAVGVQIDAPAKDGEANAAL+DYISS Sbjct: 56 SITDLSDEAVGVQIDAPAKDGEANAALLDYISS 88 >XP_019416077.1 PREDICTED: UPF0235 protein C15orf40 homolog [Lupinus angustifolius] Length = 125 Score = 60.1 bits (144), Expect = 2e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +3 Query: 486 NLVDISDEAVGVQIDAPAKDGEANAALIDYISS 584 ++ DISDEAVGVQIDAPA+DGEANAAL+DYISS Sbjct: 51 SITDISDEAVGVQIDAPARDGEANAALLDYISS 83 >NP_001238533.1 uncharacterized protein LOC100499954 [Glycine max] XP_014631612.1 PREDICTED: uncharacterized protein LOC100499954 isoform X1 [Glycine max] ACU14321.1 unknown [Glycine max] KHN09588.1 UPF0235 protein C15orf40 like [Glycine soja] KRH53866.1 hypothetical protein GLYMA_06G150900 [Glycine max] Length = 126 Score = 60.1 bits (144), Expect = 2e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +3 Query: 486 NLVDISDEAVGVQIDAPAKDGEANAALIDYISS 584 ++ DISDEAVGVQIDAPA+DGEANAAL+DYISS Sbjct: 51 SITDISDEAVGVQIDAPARDGEANAALLDYISS 83 >XP_019177259.1 PREDICTED: UPF0235 protein C15orf40 homolog [Ipomoea nil] Length = 129 Score = 60.1 bits (144), Expect = 2e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 489 LVDISDEAVGVQIDAPAKDGEANAALIDYISS 584 + D+SDEAVGVQIDAPAKDGEANAAL+DYISS Sbjct: 55 ITDLSDEAVGVQIDAPAKDGEANAALLDYISS 86 >XP_003602559.1 UPF0235 C15orf40-like protein [Medicago truncatula] AES72810.1 UPF0235 C15orf40-like protein [Medicago truncatula] Length = 125 Score = 59.7 bits (143), Expect = 3e-08 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = +3 Query: 486 NLVDISDEAVGVQIDAPAKDGEANAALIDYISS 584 ++ D+SDEAVGVQIDAPA+DGEANAAL+DYISS Sbjct: 51 SITDVSDEAVGVQIDAPARDGEANAALLDYISS 83 >NP_001237633.1 uncharacterized protein LOC100527290 [Glycine max] ACU16361.1 unknown [Glycine max] KHN31126.1 UPF0235 protein C15orf40 like [Glycine soja] KRH64084.1 hypothetical protein GLYMA_04G215300 [Glycine max] Length = 126 Score = 59.7 bits (143), Expect = 3e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +3 Query: 486 NLVDISDEAVGVQIDAPAKDGEANAALIDYISS 584 ++ DISDEAVGVQIDAPA+DGEANAAL+DYISS Sbjct: 51 SVTDISDEAVGVQIDAPARDGEANAALLDYISS 83 >GAV62780.1 DUF167 domain-containing protein, partial [Cephalotus follicularis] Length = 129 Score = 59.7 bits (143), Expect = 3e-08 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = +3 Query: 486 NLVDISDEAVGVQIDAPAKDGEANAALIDYISS 584 N+ +ISDEAVG+QIDAPA+DGEANAAL+DYISS Sbjct: 56 NITNISDEAVGIQIDAPARDGEANAALLDYISS 88 >XP_014629822.1 PREDICTED: uncharacterized protein LOC100527290 isoform X1 [Glycine max] Length = 131 Score = 59.7 bits (143), Expect = 3e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +3 Query: 486 NLVDISDEAVGVQIDAPAKDGEANAALIDYISS 584 ++ DISDEAVGVQIDAPA+DGEANAAL+DYISS Sbjct: 51 SVTDISDEAVGVQIDAPARDGEANAALLDYISS 83 >ACU17552.1 unknown, partial [Glycine max] Length = 77 Score = 58.2 bits (139), Expect = 4e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 486 NLVDISDEAVGVQIDAPAKDGEANAALIDYIS 581 ++ DISDEAVGVQIDAPA+DGEANAAL+DYIS Sbjct: 32 SVTDISDEAVGVQIDAPARDGEANAALLDYIS 63 >GAU13192.1 hypothetical protein TSUD_179350 [Trifolium subterraneum] Length = 125 Score = 59.3 bits (142), Expect = 4e-08 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = +3 Query: 486 NLVDISDEAVGVQIDAPAKDGEANAALIDYISS 584 ++ D+SDEAVGVQIDAPA+DGEANAAL+DYISS Sbjct: 51 SVTDVSDEAVGVQIDAPARDGEANAALLDYISS 83 >XP_004502908.1 PREDICTED: UPF0235 protein C15orf40 homolog [Cicer arietinum] Length = 129 Score = 59.3 bits (142), Expect = 5e-08 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = +3 Query: 486 NLVDISDEAVGVQIDAPAKDGEANAALIDYISS 584 ++ D+SDEAVGVQIDAPA+DGEANAAL+DYISS Sbjct: 51 SVTDVSDEAVGVQIDAPARDGEANAALLDYISS 83 >KRH64085.1 hypothetical protein GLYMA_04G215300 [Glycine max] Length = 96 Score = 58.2 bits (139), Expect = 6e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 486 NLVDISDEAVGVQIDAPAKDGEANAALIDYIS 581 ++ DISDEAVGVQIDAPA+DGEANAAL+DYIS Sbjct: 51 SVTDISDEAVGVQIDAPARDGEANAALLDYIS 82 >KDO40384.1 hypothetical protein CISIN_1g033057mg [Citrus sinensis] Length = 100 Score = 58.2 bits (139), Expect = 7e-08 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = +3 Query: 486 NLVDISDEAVGVQIDAPAKDGEANAALIDYISS 584 ++ D+SDEAVGVQIDAPAKDGEANAAL++Y+SS Sbjct: 54 SITDVSDEAVGVQIDAPAKDGEANAALLEYMSS 86 >KDO40385.1 hypothetical protein CISIN_1g033057mg [Citrus sinensis] Length = 101 Score = 58.2 bits (139), Expect = 7e-08 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = +3 Query: 486 NLVDISDEAVGVQIDAPAKDGEANAALIDYISS 584 ++ D+SDEAVGVQIDAPAKDGEANAAL++Y+SS Sbjct: 54 SITDVSDEAVGVQIDAPAKDGEANAALLEYMSS 86 >XP_011032559.1 PREDICTED: uncharacterized protein LOC105131332 [Populus euphratica] Length = 251 Score = 60.8 bits (146), Expect = 8e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 492 VDISDEAVGVQIDAPAKDGEANAALIDYISS 584 VD+SDEAVGVQIDAPAKDGEANAAL+DYISS Sbjct: 178 VDLSDEAVGVQIDAPAKDGEANAALLDYISS 208 >KDO40383.1 hypothetical protein CISIN_1g033057mg [Citrus sinensis] Length = 109 Score = 58.2 bits (139), Expect = 8e-08 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = +3 Query: 486 NLVDISDEAVGVQIDAPAKDGEANAALIDYISS 584 ++ D+SDEAVGVQIDAPAKDGEANAAL++Y+SS Sbjct: 54 SITDVSDEAVGVQIDAPAKDGEANAALLEYMSS 86 >XP_007048278.2 PREDICTED: UPF0235 protein C15orf40 homolog [Theobroma cacao] Length = 126 Score = 58.5 bits (140), Expect = 8e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +3 Query: 486 NLVDISDEAVGVQIDAPAKDGEANAALIDYISS 584 ++ D SD+AVGVQIDAPAKDGEANAAL+DYISS Sbjct: 52 SITDFSDDAVGVQIDAPAKDGEANAALLDYISS 84 >XP_016542769.1 PREDICTED: UPF0235 protein C15orf40 homolog [Capsicum annuum] Length = 126 Score = 58.5 bits (140), Expect = 8e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 489 LVDISDEAVGVQIDAPAKDGEANAALIDYISS 584 + D++D+AVGVQIDAPAKDGEANAALIDYISS Sbjct: 52 ITDLNDDAVGVQIDAPAKDGEANAALIDYISS 83 >KYP69410.1 UPF0235 protein C15orf40 isogeny [Cajanus cajan] Length = 126 Score = 58.5 bits (140), Expect = 8e-08 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = +3 Query: 486 NLVDISDEAVGVQIDAPAKDGEANAALIDYISS 584 ++ D+SDEAVGVQIDAPA+DGEANAAL+DYISS Sbjct: 51 SVTDMSDEAVGVQIDAPARDGEANAALLDYISS 83