BLASTX nr result
ID: Lithospermum23_contig00030098
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00030098 (497 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY28055.1 hypothetical protein MANES_15G037400 [Manihot esculenta] 55 7e-07 EEF45169.1 conserved hypothetical protein [Ricinus communis] 53 4e-06 >OAY28055.1 hypothetical protein MANES_15G037400 [Manihot esculenta] Length = 99 Score = 54.7 bits (130), Expect = 7e-07 Identities = 33/58 (56%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Frame = +3 Query: 27 EATRPL-GVLSSIEKLLQSLPAGPVPPSHASPCTYIPVGGTGSCP*SR*INNVLVAGH 197 +A+R L G L S E +LQSLP GPVPPS AS CT+IP G SCP + +N + VAGH Sbjct: 22 QASRILSGDLYSKELVLQSLPRGPVPPSGASGCTHIPNTGGPSCPNT--VNTMNVAGH 77 >EEF45169.1 conserved hypothetical protein [Ricinus communis] Length = 112 Score = 53.1 bits (126), Expect = 4e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +3 Query: 72 LQSLPAGPVPPSHASPCTYIPVGGTGSCP 158 L SL GPVPPS +SPCTYIPVGG+G CP Sbjct: 46 LNSLKKGPVPPSSSSPCTYIPVGGSGHCP 74