BLASTX nr result
ID: Lithospermum23_contig00029979
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00029979 (207 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZV36196.1 hypothetical protein F511_14214 [Dorcoceras hygrometr... 53 2e-06 XP_019707782.1 PREDICTED: protein HOMOLOG OF MAMMALIAN LYST-INTE... 49 6e-06 >KZV36196.1 hypothetical protein F511_14214 [Dorcoceras hygrometricum] Length = 419 Score = 52.8 bits (125), Expect = 2e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = +2 Query: 2 STAKTFYAASIFFEIMNQFGEVHPDVFSTFNYDA 103 +TAKTFYAASIFFEI+NQFGE+HPD+ Y A Sbjct: 103 NTAKTFYAASIFFEILNQFGELHPDLEQKQKYAA 136 >XP_019707782.1 PREDICTED: protein HOMOLOG OF MAMMALIAN LYST-INTERACTING PROTEIN 5-like [Elaeis guineensis] Length = 89 Score = 48.9 bits (115), Expect = 6e-06 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = +2 Query: 2 STAKTFYAASIFFEIMNQFGEVHPDVFSTFNY 97 +TAKTFYAASIFFEI+NQFG++ PD+ + Y Sbjct: 13 NTAKTFYAASIFFEILNQFGQLQPDIETKQKY 44