BLASTX nr result
ID: Lithospermum23_contig00029887
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00029887 (283 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011073094.1 PREDICTED: HVA22-like protein e [Sesamum indicum] 53 9e-07 XP_012854666.1 PREDICTED: HVA22-like protein e [Erythranthe gutt... 50 9e-06 >XP_011073094.1 PREDICTED: HVA22-like protein e [Sesamum indicum] Length = 136 Score = 53.1 bits (126), Expect = 9e-07 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -3 Query: 281 LPQFQGAAFLYEKFVREKVLKKYGGGFGLKSAIGKSKS 168 LPQF+GAAF+YEKFVREK++KKYGG KS K K+ Sbjct: 83 LPQFRGAAFIYEKFVREKLIKKYGGPHLQKSPNSKGKN 120 >XP_012854666.1 PREDICTED: HVA22-like protein e [Erythranthe guttata] EYU23069.1 hypothetical protein MIMGU_mgv1a016048mg [Erythranthe guttata] Length = 136 Score = 50.4 bits (119), Expect = 9e-06 Identities = 23/38 (60%), Positives = 30/38 (78%) Frame = -3 Query: 281 LPQFQGAAFLYEKFVREKVLKKYGGGFGLKSAIGKSKS 168 LPQF+GAAF+YEKFVREK++KKYG +S+ K K+ Sbjct: 83 LPQFRGAAFIYEKFVREKLIKKYGPSHLQRSSNAKGKN 120