BLASTX nr result
ID: Lithospermum23_contig00029821
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00029821 (406 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EMS53876.1 Bidirectional sugar transporter SWEET14 [Triticum ura... 58 4e-07 >EMS53876.1 Bidirectional sugar transporter SWEET14 [Triticum urartu] Length = 532 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = +1 Query: 118 NHQWRKPETGYMKVNIDAAFYKTTMSGAIGVVGRDDCGKF 237 +H W+KP G +KVN+DAAF+ T+SGA G VGRDD G+F Sbjct: 368 DHMWKKPSYGMVKVNVDAAFHADTLSGASGAVGRDDKGEF 407