BLASTX nr result
ID: Lithospermum23_contig00029784
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00029784 (305 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CAN76793.1 hypothetical protein VITISV_026680 [Vitis vinifera] 41 5e-06 >CAN76793.1 hypothetical protein VITISV_026680 [Vitis vinifera] Length = 1469 Score = 40.8 bits (94), Expect(2) = 5e-06 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -1 Query: 269 PTTFQLLMNTVFNQFLRKFVLVFF 198 PTTFQ LMN +F +LRKF+LVFF Sbjct: 694 PTTFQSLMNDIFKPYLRKFILVFF 717 Score = 36.6 bits (83), Expect(2) = 5e-06 Identities = 21/48 (43%), Positives = 24/48 (50%) Frame = -3 Query: 201 FYDILI*NKDLESXXXXXXXXXXXXXXHKRFAKMSKCALGQFEIEYLG 58 FYDIL+ +K L H+ FAK SKC G EIEYLG Sbjct: 717 FYDILVYSKSLADHVHHLQTVLDILKQHQLFAKKSKCCFGCSEIEYLG 764