BLASTX nr result
ID: Lithospermum23_contig00029769
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00029769 (488 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008238542.1 PREDICTED: uncharacterized protein LOC103337169 [... 58 4e-07 >XP_008238542.1 PREDICTED: uncharacterized protein LOC103337169 [Prunus mume] Length = 450 Score = 57.8 bits (138), Expect(2) = 4e-07 Identities = 31/76 (40%), Positives = 40/76 (52%) Frame = +3 Query: 207 SHKARCFICDSLMHLANSCTHRSSAPQVHLADAYSQQVRSSPYTTQPCIP*VPDTGATHH 386 S+ RC IC+ HLA +C +R P DA + Y+ PDTGATHH Sbjct: 310 SNTTRCQICNQTNHLAATCRYRYDKPN----DASAHIASFPAYSNSDFNTGFPDTGATHH 365 Query: 387 ITPDLASLQISEPYLG 434 +TPDLA+L I+ Y G Sbjct: 366 VTPDLANLSIANNYNG 381 Score = 23.5 bits (49), Expect(2) = 4e-07 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 433 GSDGLQVANGQQMNIAH 483 G D L+V NG +NI+H Sbjct: 381 GPDQLKVGNGNGLNISH 397