BLASTX nr result
ID: Lithospermum23_contig00029724
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00029724 (478 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CAN73165.1 hypothetical protein VITISV_027980 [Vitis vinifera] 55 9e-06 >CAN73165.1 hypothetical protein VITISV_027980 [Vitis vinifera] Length = 493 Score = 54.7 bits (130), Expect = 9e-06 Identities = 27/47 (57%), Positives = 32/47 (68%) Frame = +2 Query: 338 QQEHVEEGDSNKSSPSPQQVEAWLPITESRKSNLLTTLFHLISSGIG 478 Q++ + DS K PSPQ E WLPITESRK T+ FHL+SSGIG Sbjct: 30 QEDWLPVSDSRKEVPSPQ--EGWLPITESRKGGAXTSAFHLLSSGIG 74