BLASTX nr result
ID: Lithospermum23_contig00029633
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00029633 (311 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012831870.1 PREDICTED: threonine dehydratase biosynthetic, ch... 60 3e-08 EYU38592.1 hypothetical protein MIMGU_mgv1a003122mg [Erythranthe... 59 8e-08 EYU41567.1 hypothetical protein MIMGU_mgv1a003249mg [Erythranthe... 59 8e-08 XP_011094452.1 PREDICTED: LOW QUALITY PROTEIN: threonine dehydra... 59 8e-08 XP_012836070.1 PREDICTED: threonine dehydratase biosynthetic, ch... 59 8e-08 XP_011101468.1 PREDICTED: threonine dehydratase biosynthetic, ch... 59 8e-08 EPS59945.1 chloroplast threonine deaminase 1, partial [Genlisea ... 57 3e-07 KZV29470.1 chloroplast threonine deaminase 1 precursor [Dorcocer... 57 3e-07 OIS98035.1 threonine dehydratase biosynthetic, chloroplastic [Ni... 55 1e-06 XP_019254717.1 PREDICTED: threonine dehydratase biosynthetic, ch... 55 1e-06 XP_009774928.1 PREDICTED: threonine dehydratase biosynthetic, ch... 55 2e-06 XP_006339100.1 PREDICTED: threonine dehydratase biosynthetic, ch... 55 2e-06 KZV39106.1 chloroplast threonine deaminase 1 precursor [Dorcocer... 54 2e-06 XP_016455948.1 PREDICTED: threonine dehydratase biosynthetic, ch... 54 4e-06 XP_009593366.1 PREDICTED: threonine dehydratase biosynthetic, ch... 54 4e-06 XP_016499616.1 PREDICTED: threonine dehydratase biosynthetic, ch... 53 8e-06 XP_015055759.1 PREDICTED: threonine dehydratase biosynthetic, ch... 53 8e-06 NP_001234234.1 chloroplast threonine deaminase 1 precursor [Sola... 53 8e-06 >XP_012831870.1 PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like [Erythranthe guttata] Length = 612 Score = 59.7 bits (143), Expect = 3e-08 Identities = 39/83 (46%), Positives = 47/83 (56%), Gaps = 12/83 (14%) Frame = +3 Query: 99 IRPKAAINNPRHHLLLKSMTMQCEQGFLIPNKTSGEGGM-----NAMEYLGNIRESMV-- 257 + P A R L + ++QCE G+LIPN GG+ NAMEYL NI S V Sbjct: 66 LNPPANPAADRPLLRVSPSSLQCESGYLIPNDYMDNGGVRKGSPNAMEYLTNILSSKVYD 125 Query: 258 --YESPLQLATRL---LGVNMWL 311 YESPLQLAT+L GVN+WL Sbjct: 126 VAYESPLQLATKLSERWGVNVWL 148 >EYU38592.1 hypothetical protein MIMGU_mgv1a003122mg [Erythranthe guttata] Length = 518 Score = 58.5 bits (140), Expect = 8e-08 Identities = 36/70 (51%), Positives = 44/70 (62%), Gaps = 12/70 (17%) Frame = +3 Query: 138 LLLKSMTMQCEQGFLIPNKTSG-----EGGMNAMEYLGNIRESMV----YESPLQLATRL 290 L + ++QCE G L+PN+ G EG +NAMEYL NI S V YESPLQLAT+L Sbjct: 73 LRVSPSSLQCESGRLLPNENLGRGVVAEGTLNAMEYLTNILASKVYDVAYESPLQLATKL 132 Query: 291 ---LGVNMWL 311 GVN+WL Sbjct: 133 SERWGVNIWL 142 >EYU41567.1 hypothetical protein MIMGU_mgv1a003249mg [Erythranthe guttata] Length = 597 Score = 58.5 bits (140), Expect = 8e-08 Identities = 35/64 (54%), Positives = 41/64 (64%), Gaps = 12/64 (18%) Frame = +3 Query: 156 TMQCEQGFLIPNKTSGEGGM-----NAMEYLGNIRESMV----YESPLQLATRL---LGV 299 ++QCE G+LIPN GG+ NAMEYL NI S V YESPLQLAT+L GV Sbjct: 70 SLQCESGYLIPNDYMDNGGVRKGSPNAMEYLTNILSSKVYDVAYESPLQLATKLSERWGV 129 Query: 300 NMWL 311 N+WL Sbjct: 130 NVWL 133 >XP_011094452.1 PREDICTED: LOW QUALITY PROTEIN: threonine dehydratase biosynthetic, chloroplastic [Sesamum indicum] Length = 604 Score = 58.5 bits (140), Expect = 8e-08 Identities = 32/70 (45%), Positives = 45/70 (64%), Gaps = 12/70 (17%) Frame = +3 Query: 138 LLLKSMTMQCEQGFLIPNKTSGEGG-----MNAMEYLGNIRESMV----YESPLQLATRL 290 L + + ++QCE G+L+PN+ G+G +NAMEYL NI S V YESP QLA+++ Sbjct: 74 LRVSASSLQCESGYLVPNENPGDGAVSNGTLNAMEYLTNILSSKVYDVAYESPFQLASKM 133 Query: 291 ---LGVNMWL 311 GVN+WL Sbjct: 134 SERWGVNVWL 143 >XP_012836070.1 PREDICTED: threonine dehydratase biosynthetic, chloroplastic isoform X1 [Erythranthe guttata] EYU38591.1 hypothetical protein MIMGU_mgv1a003122mg [Erythranthe guttata] Length = 606 Score = 58.5 bits (140), Expect = 8e-08 Identities = 36/70 (51%), Positives = 44/70 (62%), Gaps = 12/70 (17%) Frame = +3 Query: 138 LLLKSMTMQCEQGFLIPNKTSG-----EGGMNAMEYLGNIRESMV----YESPLQLATRL 290 L + ++QCE G L+PN+ G EG +NAMEYL NI S V YESPLQLAT+L Sbjct: 73 LRVSPSSLQCESGRLLPNENLGRGVVAEGTLNAMEYLTNILASKVYDVAYESPLQLATKL 132 Query: 291 ---LGVNMWL 311 GVN+WL Sbjct: 133 SERWGVNIWL 142 >XP_011101468.1 PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like [Sesamum indicum] Length = 610 Score = 58.5 bits (140), Expect = 8e-08 Identities = 45/113 (39%), Positives = 59/113 (52%), Gaps = 19/113 (16%) Frame = +3 Query: 30 SQLKVKIQLT-DNNGTCSLPLFYSIRPKAAINNPRHH------LLLKSMTMQCEQGFLIP 188 S+LK I T N G LP I +N P L + ++QC+ G+++P Sbjct: 34 SRLKPLIYATLSNPGAEILPSAEKIPRVPPLNGPIPSTPSAPLLRVSPSSLQCDSGYMLP 93 Query: 189 NKTSG-----EGGMNAMEYLGNIRESMV----YESPLQLATRL---LGVNMWL 311 N+ G +G +NAMEYL NI S V YESPLQLAT+L GVN+WL Sbjct: 94 NENLGRTVVNDGTLNAMEYLTNILASRVYDVAYESPLQLATKLSERWGVNVWL 146 >EPS59945.1 chloroplast threonine deaminase 1, partial [Genlisea aurea] Length = 432 Score = 57.0 bits (136), Expect = 3e-07 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 12/70 (17%) Frame = +3 Query: 138 LLLKSMTMQCEQGFLIPNKT-----SGEGGMNAMEYLGNIRESMV----YESPLQLATRL 290 L + ++QCE G+L+PNK SG+G ++ M+YL NI S V YESPLQLA++L Sbjct: 47 LKVSPSSLQCESGYLVPNKNMGYGISGDGTLSPMQYLTNILGSKVYDLAYESPLQLASKL 106 Query: 291 ---LGVNMWL 311 GVN+WL Sbjct: 107 SGSWGVNVWL 116 >KZV29470.1 chloroplast threonine deaminase 1 precursor [Dorcoceras hygrometricum] Length = 608 Score = 57.0 bits (136), Expect = 3e-07 Identities = 33/65 (50%), Positives = 41/65 (63%), Gaps = 13/65 (20%) Frame = +3 Query: 156 TMQCEQGFLIPNKT------SGEGGMNAMEYLGNIRESMV----YESPLQLATRL---LG 296 ++QCE G+L PN+ + G +NAMEYL NI S V YESPLQLAT+L G Sbjct: 80 SLQCESGYLTPNRNLSGNGAASSGSLNAMEYLTNILSSKVYDVAYESPLQLATQLSQRWG 139 Query: 297 VNMWL 311 VN+WL Sbjct: 140 VNVWL 144 >OIS98035.1 threonine dehydratase biosynthetic, chloroplastic [Nicotiana attenuata] Length = 566 Score = 55.1 bits (131), Expect = 1e-06 Identities = 33/70 (47%), Positives = 43/70 (61%), Gaps = 8/70 (11%) Frame = +3 Query: 126 PRHHLLLKSMTMQCEQGFLIPN-KTSGEGGMNAMEYLGNIRESMVY----ESPLQLATRL 290 P L++ ++QCE G+LIPN G GG N +YL +I + VY ESPLQLA +L Sbjct: 32 PTPLLVVSPNSLQCEPGYLIPNYPVGGNGGENGFQYLVDILGTKVYDVANESPLQLAPKL 91 Query: 291 ---LGVNMWL 311 LGVN+WL Sbjct: 92 SEKLGVNVWL 101 >XP_019254717.1 PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like [Nicotiana attenuata] Length = 603 Score = 55.1 bits (131), Expect = 1e-06 Identities = 33/70 (47%), Positives = 43/70 (61%), Gaps = 8/70 (11%) Frame = +3 Query: 126 PRHHLLLKSMTMQCEQGFLIPN-KTSGEGGMNAMEYLGNIRESMVY----ESPLQLATRL 290 P L++ ++QCE G+LIPN G GG N +YL +I + VY ESPLQLA +L Sbjct: 69 PTPLLVVSPNSLQCEPGYLIPNYPVGGNGGENGFQYLVDILGTKVYDVANESPLQLAPKL 128 Query: 291 ---LGVNMWL 311 LGVN+WL Sbjct: 129 SEKLGVNVWL 138 >XP_009774928.1 PREDICTED: threonine dehydratase biosynthetic, chloroplastic [Nicotiana sylvestris] Length = 602 Score = 54.7 bits (130), Expect = 2e-06 Identities = 41/107 (38%), Positives = 56/107 (52%), Gaps = 9/107 (8%) Frame = +3 Query: 18 INQNSQLKVK-IQLTDNNGTCSLPLFYSIRPKAAINNPRHHLLLKSMTMQCEQGFLIPNK 194 IN+N+ ++ K +++ + PL S P + L + ++QCE GFLIPN Sbjct: 38 INRNAFIRAKAVEILSSPVAAPEPLQDSPAPSVPL------LRVSPSSLQCEPGFLIPNS 91 Query: 195 -TSGEGGMNAMEYLGNIRESMV----YESPLQLATRL---LGVNMWL 311 G GG EYL NI S V YE+PLQ A +L LGVN+WL Sbjct: 92 PVLGTGGKLGYEYLTNILSSKVYDVAYETPLQNAPKLSERLGVNVWL 138 >XP_006339100.1 PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like [Solanum tuberosum] Length = 609 Score = 54.7 bits (130), Expect = 2e-06 Identities = 38/95 (40%), Positives = 51/95 (53%), Gaps = 8/95 (8%) Frame = +3 Query: 51 QLTDNNGTCSLPLFYSIRPKAAINNPRHHLLLKSMTMQCEQGFLIPNK-TSGEGGMNAME 227 ++ + T + PL P A P L + ++QCE G+LIPN G GG++ E Sbjct: 53 EILSSPATVTEPL--KAEPVEAPEAPVPLLRVSPSSLQCEPGYLIPNTPVLGTGGVSGYE 110 Query: 228 YLGNIRESMV----YESPLQLATRL---LGVNMWL 311 YL NI S V YE+PLQ A +L LGVN+WL Sbjct: 111 YLTNILSSKVYDVAYETPLQKAPKLSERLGVNVWL 145 >KZV39106.1 chloroplast threonine deaminase 1 precursor [Dorcoceras hygrometricum] Length = 605 Score = 54.3 bits (129), Expect = 2e-06 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 12/64 (18%) Frame = +3 Query: 156 TMQCEQGFLIPNKTSGE-----GGMNAMEYLGNIRESMV----YESPLQLATRL---LGV 299 ++QC+ G+L+ N+ G G +NAM+YL NI S V YESPLQLAT+L GV Sbjct: 79 SLQCDSGYLVRNENLGNVAVSNGALNAMQYLTNILSSKVYDVAYESPLQLATKLSERWGV 138 Query: 300 NMWL 311 N+WL Sbjct: 139 NVWL 142 >XP_016455948.1 PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like [Nicotiana tabacum] Length = 603 Score = 53.5 bits (127), Expect = 4e-06 Identities = 32/70 (45%), Positives = 43/70 (61%), Gaps = 8/70 (11%) Frame = +3 Query: 126 PRHHLLLKSMTMQCEQGFLIPN-KTSGEGGMNAMEYLGNIRESMVY----ESPLQLATRL 290 P L++ +++CE G+LIPN G GG N +YL +I + VY ESPLQLA +L Sbjct: 69 PTPLLVVSPNSLRCEPGYLIPNYPVGGNGGENGFQYLVDILGTKVYDVANESPLQLAPKL 128 Query: 291 ---LGVNMWL 311 LGVN+WL Sbjct: 129 SQKLGVNVWL 138 >XP_009593366.1 PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like [Nicotiana tomentosiformis] Length = 603 Score = 53.5 bits (127), Expect = 4e-06 Identities = 32/70 (45%), Positives = 43/70 (61%), Gaps = 8/70 (11%) Frame = +3 Query: 126 PRHHLLLKSMTMQCEQGFLIPN-KTSGEGGMNAMEYLGNIRESMVY----ESPLQLATRL 290 P L++ +++CE G+LIPN G GG N +YL +I + VY ESPLQLA +L Sbjct: 69 PTPLLVVSPNSLRCEPGYLIPNYPVGGNGGENGFQYLVDILGTKVYDVANESPLQLAPKL 128 Query: 291 ---LGVNMWL 311 LGVN+WL Sbjct: 129 SQKLGVNVWL 138 >XP_016499616.1 PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like [Nicotiana tabacum] Length = 602 Score = 52.8 bits (125), Expect = 8e-06 Identities = 40/107 (37%), Positives = 56/107 (52%), Gaps = 9/107 (8%) Frame = +3 Query: 18 INQNSQLKVK-IQLTDNNGTCSLPLFYSIRPKAAINNPRHHLLLKSMTMQCEQGFLIPNK 194 IN+++ ++ K +++ + PL S P + L + ++QCE GFLIPN Sbjct: 38 INRSAFIRAKAVEILSSPVAAPEPLQDSPAPSVPL------LRVSPSSLQCEPGFLIPNS 91 Query: 195 -TSGEGGMNAMEYLGNIRESMV----YESPLQLATRL---LGVNMWL 311 G GG EYL NI S V YE+PLQ A +L LGVN+WL Sbjct: 92 PVLGTGGKLGYEYLTNILSSKVYDVAYETPLQNAPKLSERLGVNVWL 138 >XP_015055759.1 PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like [Solanum pennellii] Length = 606 Score = 52.8 bits (125), Expect = 8e-06 Identities = 31/66 (46%), Positives = 40/66 (60%), Gaps = 8/66 (12%) Frame = +3 Query: 138 LLLKSMTMQCEQGFLIPNK-TSGEGGMNAMEYLGNIRESMV----YESPLQLATRL---L 293 L + ++QCE G+L+PN G GG+ EYL NI S V YE+PLQ A +L L Sbjct: 77 LRVSPSSLQCEPGYLLPNSPVLGTGGVTGYEYLTNILSSKVYDVAYETPLQKAPKLSERL 136 Query: 294 GVNMWL 311 GVN+WL Sbjct: 137 GVNVWL 142 >NP_001234234.1 chloroplast threonine deaminase 1 precursor [Solanum lycopersicum] ABK20067.1 chloroplast threonine deaminase 1 precursor [Solanum lycopersicum] Length = 606 Score = 52.8 bits (125), Expect = 8e-06 Identities = 31/66 (46%), Positives = 40/66 (60%), Gaps = 8/66 (12%) Frame = +3 Query: 138 LLLKSMTMQCEQGFLIPNK-TSGEGGMNAMEYLGNIRESMV----YESPLQLATRL---L 293 L + ++QCE G+L+PN G GG+ EYL NI S V YE+PLQ A +L L Sbjct: 77 LRVSPSSLQCEPGYLLPNSPVLGTGGVTGYEYLTNILSSKVYDVAYETPLQKAPKLSERL 136 Query: 294 GVNMWL 311 GVN+WL Sbjct: 137 GVNVWL 142