BLASTX nr result
ID: Lithospermum23_contig00029618
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00029618 (354 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006378353.1 hypothetical protein POPTR_0010s08630g [Populus t... 52 9e-07 XP_002314644.1 hypothetical protein POPTR_0010s08610g [Populus t... 50 7e-06 XP_006387620.1 hypothetical protein POPTR_0770s00230g [Populus t... 50 7e-06 >XP_006378353.1 hypothetical protein POPTR_0010s08630g [Populus trichocarpa] ERP56150.1 hypothetical protein POPTR_0010s08630g [Populus trichocarpa] Length = 70 Score = 52.4 bits (124), Expect = 9e-07 Identities = 22/42 (52%), Positives = 33/42 (78%) Frame = -1 Query: 351 QNKMVKAIIVDKDALLILNFDCNRVWVKVDKSGIVAVIPQLG 226 +N +V+AIIV + + +I+NF C+RVWV VDK GIV ++P +G Sbjct: 29 ENPLVEAIIVPEGSSVIMNFQCDRVWVWVDKDGIVYIVPVIG 70 >XP_002314644.1 hypothetical protein POPTR_0010s08610g [Populus trichocarpa] XP_006387618.1 hypothetical protein POPTR_0770s00210g [Populus trichocarpa] EEF00815.1 hypothetical protein POPTR_0010s08610g [Populus trichocarpa] ERP46532.1 hypothetical protein POPTR_0770s00210g [Populus trichocarpa] Length = 70 Score = 50.1 bits (118), Expect = 7e-06 Identities = 22/42 (52%), Positives = 32/42 (76%) Frame = -1 Query: 351 QNKMVKAIIVDKDALLILNFDCNRVWVKVDKSGIVAVIPQLG 226 +N +V+AIIV + + +I NF C+RVWV VDK GIV ++P +G Sbjct: 29 ENPLVEAIIVPEGSSIIENFRCDRVWVWVDKDGIVYIVPVIG 70 >XP_006387620.1 hypothetical protein POPTR_0770s00230g [Populus trichocarpa] ERP46534.1 hypothetical protein POPTR_0770s00230g [Populus trichocarpa] Length = 70 Score = 50.1 bits (118), Expect = 7e-06 Identities = 22/42 (52%), Positives = 32/42 (76%) Frame = -1 Query: 351 QNKMVKAIIVDKDALLILNFDCNRVWVKVDKSGIVAVIPQLG 226 +N +V+AIIV + + +I NF C+RVWV VDK GIV ++P +G Sbjct: 29 ENPLVEAIIVPEGSSIIENFRCDRVWVWVDKDGIVYIVPVIG 70