BLASTX nr result
ID: Lithospermum23_contig00029418
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00029418 (378 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ONK74435.1 uncharacterized protein A4U43_C03F6180 [Asparagus off... 54 7e-06 >ONK74435.1 uncharacterized protein A4U43_C03F6180 [Asparagus officinalis] Length = 821 Score = 53.9 bits (128), Expect = 7e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = +3 Query: 255 DSSFSGNDTFDASQYAFFGGKDKVEDAELGGIEDED 362 DSS + N FDASQYAFFGGK+ V++ ELGG+ED+D Sbjct: 24 DSSSTDNARFDASQYAFFGGKNVVKEVELGGLEDDD 59