BLASTX nr result
ID: Lithospermum23_contig00029382
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00029382 (252 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015077463.1 PREDICTED: tetraspanin-3-like [Solanum pennellii] 64 6e-10 XP_017184320.1 PREDICTED: tetraspanin-3-like [Malus domestica] 61 1e-09 GAU14649.1 hypothetical protein TSUD_97130 [Trifolium subterraneum] 59 3e-09 XP_008363477.2 PREDICTED: tetraspanin-3-like [Malus domestica] 61 3e-09 KZV48532.1 tetraspanin-3 [Dorcoceras hygrometricum] 60 6e-09 XP_006592227.2 PREDICTED: tetraspanin-3 [Glycine max] KHN05715.1... 60 6e-09 XP_002284871.1 PREDICTED: tetraspanin-3 [Vitis vinifera] 60 6e-09 OIW09156.1 hypothetical protein TanjilG_11294 [Lupinus angustifo... 60 6e-09 EYU35761.1 hypothetical protein MIMGU_mgv11b019302mg [Erythranth... 57 6e-09 NP_001326332.1 tetraspanin3 [Arabidopsis thaliana] ANM64293.1 te... 59 7e-09 XP_002526335.1 PREDICTED: tetraspanin-3 [Ricinus communis] EEF36... 60 1e-08 ACJ84677.1 unknown [Medicago truncatula] 59 1e-08 KVH99892.1 Tetraspanin [Cynara cardunculus var. scolymus] 59 1e-08 OAP06755.1 TET3 [Arabidopsis thaliana] 59 2e-08 KYP68470.1 hypothetical protein KK1_022096 [Cajanus cajan] 59 2e-08 XP_003606498.1 tetraspanin family protein [Medicago truncatula] ... 59 2e-08 XP_010520340.1 PREDICTED: tetraspanin-3 [Tarenaya hassleriana] 59 2e-08 XP_010535582.1 PREDICTED: tetraspanin-3-like [Tarenaya hassleriana] 59 2e-08 XP_010425983.1 PREDICTED: tetraspanin-3-like [Camelina sativa] 59 2e-08 XP_010514887.1 PREDICTED: tetraspanin-3-like [Camelina sativa] 59 2e-08 >XP_015077463.1 PREDICTED: tetraspanin-3-like [Solanum pennellii] Length = 351 Score = 63.5 bits (153), Expect = 6e-10 Identities = 36/71 (50%), Positives = 44/71 (61%), Gaps = 9/71 (12%) Frame = +2 Query: 65 ILLKSQTF-------NSLHSKPTQER--VQHPIFFKKYNTIKMKTSNHLIGLLNFITFLL 217 IL+K TF + + K QE + P KK + M+TSNHLIGL+NF+TFL Sbjct: 24 ILIKKDTFFFFVQKHSHIKKKKFQESPYTRTPQKIKKQSLFSMRTSNHLIGLVNFLTFLA 83 Query: 218 SIPILGGGIWL 250 SIPILGGGIWL Sbjct: 84 SIPILGGGIWL 94 >XP_017184320.1 PREDICTED: tetraspanin-3-like [Malus domestica] Length = 183 Score = 60.8 bits (146), Expect = 1e-09 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +2 Query: 164 MKTSNHLIGLLNFITFLLSIPILGGGIWL 250 M+TSNHLIGLLNF+TFLLSIPILGGGIWL Sbjct: 2 MRTSNHLIGLLNFVTFLLSIPILGGGIWL 30 >GAU14649.1 hypothetical protein TSUD_97130 [Trifolium subterraneum] Length = 139 Score = 59.3 bits (142), Expect = 3e-09 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +2 Query: 164 MKTSNHLIGLLNFITFLLSIPILGGGIWL 250 M+TSNHLIG+LNF+TFLLSIPILGGGIWL Sbjct: 1 MRTSNHLIGVLNFLTFLLSIPILGGGIWL 29 >XP_008363477.2 PREDICTED: tetraspanin-3-like [Malus domestica] Length = 285 Score = 61.2 bits (147), Expect = 3e-09 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 164 MKTSNHLIGLLNFITFLLSIPILGGGIWL 250 M+TSNHLIGLLNFITFLLSIPILGGGIWL Sbjct: 1 MRTSNHLIGLLNFITFLLSIPILGGGIWL 29 >KZV48532.1 tetraspanin-3 [Dorcoceras hygrometricum] Length = 285 Score = 60.5 bits (145), Expect = 6e-09 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +2 Query: 164 MKTSNHLIGLLNFITFLLSIPILGGGIWL 250 M+TSNHLIGLLNF+TFLLSIPILGGGIWL Sbjct: 1 MRTSNHLIGLLNFLTFLLSIPILGGGIWL 29 >XP_006592227.2 PREDICTED: tetraspanin-3 [Glycine max] KHN05715.1 hypothetical protein glysoja_024681 [Glycine soja] KRH24933.1 hypothetical protein GLYMA_12G072100 [Glycine max] Length = 285 Score = 60.5 bits (145), Expect = 6e-09 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +2 Query: 164 MKTSNHLIGLLNFITFLLSIPILGGGIWL 250 M+TSNHLIGLLNF+TFLLSIPILGGGIWL Sbjct: 1 MRTSNHLIGLLNFLTFLLSIPILGGGIWL 29 >XP_002284871.1 PREDICTED: tetraspanin-3 [Vitis vinifera] Length = 285 Score = 60.5 bits (145), Expect = 6e-09 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +2 Query: 164 MKTSNHLIGLLNFITFLLSIPILGGGIWL 250 M+TSNHLIGLLNF+TFLLSIPILGGGIWL Sbjct: 1 MRTSNHLIGLLNFLTFLLSIPILGGGIWL 29 >OIW09156.1 hypothetical protein TanjilG_11294 [Lupinus angustifolius] Length = 287 Score = 60.5 bits (145), Expect = 6e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +2 Query: 158 IKMKTSNHLIGLLNFITFLLSIPILGGGIWL 250 +KM+TSNHLIGLLNF+TFLLSIPILG GIWL Sbjct: 1 MKMRTSNHLIGLLNFLTFLLSIPILGSGIWL 31 >EYU35761.1 hypothetical protein MIMGU_mgv11b019302mg [Erythranthe guttata] Length = 99 Score = 57.4 bits (137), Expect = 6e-09 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +2 Query: 164 MKTSNHLIGLLNFITFLLSIPILGGGIWL 250 M+TSNHLIG LNF+TF+LSIPILGGGIWL Sbjct: 1 MRTSNHLIGALNFLTFVLSIPILGGGIWL 29 >NP_001326332.1 tetraspanin3 [Arabidopsis thaliana] ANM64293.1 tetraspanin3 [Arabidopsis thaliana] Length = 201 Score = 59.3 bits (142), Expect = 7e-09 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +2 Query: 164 MKTSNHLIGLLNFITFLLSIPILGGGIWL 250 M+TSNHLIGL+NF+TFLLSIPILGGGIWL Sbjct: 1 MRTSNHLIGLVNFLTFLLSIPILGGGIWL 29 >XP_002526335.1 PREDICTED: tetraspanin-3 [Ricinus communis] EEF36006.1 conserved hypothetical protein [Ricinus communis] Length = 284 Score = 59.7 bits (143), Expect = 1e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +2 Query: 164 MKTSNHLIGLLNFITFLLSIPILGGGIWL 250 M++SNHLIGLLNFITFLLSIPILGGGIWL Sbjct: 1 MRSSNHLIGLLNFITFLLSIPILGGGIWL 29 >ACJ84677.1 unknown [Medicago truncatula] Length = 258 Score = 59.3 bits (142), Expect = 1e-08 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +2 Query: 164 MKTSNHLIGLLNFITFLLSIPILGGGIWL 250 M+TSNHLIG+LNF+TFLLSIPILGGGIWL Sbjct: 1 MRTSNHLIGVLNFLTFLLSIPILGGGIWL 29 >KVH99892.1 Tetraspanin [Cynara cardunculus var. scolymus] Length = 266 Score = 59.3 bits (142), Expect = 1e-08 Identities = 25/29 (86%), Positives = 29/29 (100%) Frame = +2 Query: 164 MKTSNHLIGLLNFITFLLSIPILGGGIWL 250 M+TSNHLIG+LNF+TFLLS+PILGGGIWL Sbjct: 1 MRTSNHLIGMLNFLTFLLSVPILGGGIWL 29 >OAP06755.1 TET3 [Arabidopsis thaliana] Length = 285 Score = 59.3 bits (142), Expect = 2e-08 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +2 Query: 164 MKTSNHLIGLLNFITFLLSIPILGGGIWL 250 M+TSNHLIGL+NF+TFLLSIPILGGGIWL Sbjct: 1 MRTSNHLIGLVNFLTFLLSIPILGGGIWL 29 >KYP68470.1 hypothetical protein KK1_022096 [Cajanus cajan] Length = 285 Score = 59.3 bits (142), Expect = 2e-08 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +2 Query: 164 MKTSNHLIGLLNFITFLLSIPILGGGIWL 250 M+TSNHLIG+LNF+TFLLSIPILGGGIWL Sbjct: 1 MRTSNHLIGVLNFLTFLLSIPILGGGIWL 29 >XP_003606498.1 tetraspanin family protein [Medicago truncatula] AES88695.1 tetraspanin family protein [Medicago truncatula] Length = 285 Score = 59.3 bits (142), Expect = 2e-08 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +2 Query: 164 MKTSNHLIGLLNFITFLLSIPILGGGIWL 250 M+TSNHLIG+LNF+TFLLSIPILGGGIWL Sbjct: 1 MRTSNHLIGVLNFLTFLLSIPILGGGIWL 29 >XP_010520340.1 PREDICTED: tetraspanin-3 [Tarenaya hassleriana] Length = 285 Score = 59.3 bits (142), Expect = 2e-08 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +2 Query: 164 MKTSNHLIGLLNFITFLLSIPILGGGIWL 250 M+TSNHLIGL+NF+TFLLSIPILGGGIWL Sbjct: 1 MRTSNHLIGLVNFLTFLLSIPILGGGIWL 29 >XP_010535582.1 PREDICTED: tetraspanin-3-like [Tarenaya hassleriana] Length = 285 Score = 59.3 bits (142), Expect = 2e-08 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +2 Query: 164 MKTSNHLIGLLNFITFLLSIPILGGGIWL 250 M+TSNHLIGL+NF+TFLLSIPILGGGIWL Sbjct: 1 MRTSNHLIGLVNFLTFLLSIPILGGGIWL 29 >XP_010425983.1 PREDICTED: tetraspanin-3-like [Camelina sativa] Length = 285 Score = 59.3 bits (142), Expect = 2e-08 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +2 Query: 164 MKTSNHLIGLLNFITFLLSIPILGGGIWL 250 M+TSNHLIGL+NF+TFLLSIPILGGGIWL Sbjct: 1 MRTSNHLIGLVNFLTFLLSIPILGGGIWL 29 >XP_010514887.1 PREDICTED: tetraspanin-3-like [Camelina sativa] Length = 285 Score = 59.3 bits (142), Expect = 2e-08 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +2 Query: 164 MKTSNHLIGLLNFITFLLSIPILGGGIWL 250 M+TSNHLIGL+NF+TFLLSIPILGGGIWL Sbjct: 1 MRTSNHLIGLVNFLTFLLSIPILGGGIWL 29