BLASTX nr result
ID: Lithospermum23_contig00029034
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00029034 (258 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_063096121.1 hypothetical protein [Thalassospira xiamenensis] ... 55 1e-07 XP_020050895.1 hypothetical protein ASPACDRAFT_1877672 [Aspergil... 52 9e-07 XP_007928849.1 hypothetical protein MYCFIDRAFT_54532 [Pseudocerc... 54 9e-07 KOS36100.1 hypothetical protein ACN38_g13205 [Penicillium nordic... 51 4e-06 >WP_063096121.1 hypothetical protein [Thalassospira xiamenensis] KZD03406.1 hypothetical protein AUP45_22295 [Thalassospira xiamenensis] Length = 113 Score = 54.7 bits (130), Expect = 1e-07 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -2 Query: 83 RRAQVWLQALPFQQFHVLFNSLFKVLF 3 RRAQVW QALPFQQFHVLFN LFKVLF Sbjct: 3 RRAQVWSQALPFQQFHVLFNPLFKVLF 29 >XP_020050895.1 hypothetical protein ASPACDRAFT_1877672 [Aspergillus aculeatus ATCC 16872] XP_020050892.1 hypothetical protein ASPACDRAFT_37813 [Aspergillus aculeatus ATCC 16872] OJJ94552.1 hypothetical protein ASPACDRAFT_37813 [Aspergillus aculeatus ATCC 16872] OJJ94555.1 hypothetical protein ASPACDRAFT_1877672 [Aspergillus aculeatus ATCC 16872] Length = 118 Score = 52.4 bits (124), Expect = 9e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -2 Query: 113 GVTQPKGRGNRRAQVWLQALPFQQFHVLFNSLFKVLF 3 G T + R +VW QALPFQQFHVLFNSLFKVLF Sbjct: 63 GSTPARVPAEPRGRVWSQALPFQQFHVLFNSLFKVLF 99 >XP_007928849.1 hypothetical protein MYCFIDRAFT_54532 [Pseudocercospora fijiensis CIRAD86] EME80501.1 hypothetical protein MYCFIDRAFT_54532 [Pseudocercospora fijiensis CIRAD86] Length = 181 Score = 53.5 bits (127), Expect = 9e-07 Identities = 36/78 (46%), Positives = 44/78 (56%) Frame = -3 Query: 235 ARSSVPGGRMTPEAISLPPKE*IHSSSL*PTPRTDVGLDTTE*PNQKEGGTAALKSGCKR 56 AR+S PG R + P +E +HSS L +T + ++ TAA KSGC R Sbjct: 24 ARTS-PGTRCITRGYNTPRRE-LHSSGLIQRSQTMMASRRRVNRSEDRPNTAA-KSGCGR 80 Query: 55 FPFNNFTYCLTLFSKCFS 2 FPFNNFT LTLF KCFS Sbjct: 81 FPFNNFTCFLTLFPKCFS 98 >KOS36100.1 hypothetical protein ACN38_g13205 [Penicillium nordicum] KUM55552.1 hypothetical protein ACN42_g11702 [Penicillium freii] Length = 136 Score = 51.2 bits (121), Expect = 4e-06 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = -2 Query: 80 RAQVWLQALPFQQFHVLFNSLFKVLF 3 R +VW QALPFQQFHVLFNSLFKVLF Sbjct: 6 RERVWSQALPFQQFHVLFNSLFKVLF 31