BLASTX nr result
ID: Lithospermum23_contig00028976
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00028976 (550 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012851581.1 PREDICTED: zinc finger MYM-type protein 1-like [E... 82 9e-15 XP_012851579.1 PREDICTED: zinc finger MYM-type protein 1-like [E... 79 5e-14 XP_012855091.1 PREDICTED: zinc finger MYM-type protein 1-like [E... 79 8e-14 XP_013451349.1 hypothetical protein MTR_6g022200 [Medicago trunc... 61 9e-09 XP_008245511.1 PREDICTED: zinc finger MYM-type protein 1-like [P... 57 4e-06 >XP_012851581.1 PREDICTED: zinc finger MYM-type protein 1-like [Erythranthe guttata] Length = 807 Score = 81.6 bits (200), Expect = 9e-15 Identities = 40/62 (64%), Positives = 44/62 (70%), Gaps = 3/62 (4%) Frame = +2 Query: 107 PNIEPSFQSP---NVTFKKGGYLESDPYKRTQILDYHPNDQDEVRRAYLVKRPTKPKLGN 277 P+ PS P N FKKG YLE DP KRT ILDYHPNDQDEVRRAYLV PT+P + + Sbjct: 42 PSSTPSSSDPPSSNKVFKKGEYLELDPGKRTPILDYHPNDQDEVRRAYLVNGPTRPNMTD 101 Query: 278 YP 283 YP Sbjct: 102 YP 103 >XP_012851579.1 PREDICTED: zinc finger MYM-type protein 1-like [Erythranthe guttata] Length = 563 Score = 79.3 bits (194), Expect = 5e-14 Identities = 39/62 (62%), Positives = 43/62 (69%), Gaps = 3/62 (4%) Frame = +2 Query: 107 PNIEPSFQSP---NVTFKKGGYLESDPYKRTQILDYHPNDQDEVRRAYLVKRPTKPKLGN 277 P+ PS P N KKG YLE DP KRT ILDYHPNDQDEVRRAYLV PT+P + + Sbjct: 42 PSSTPSSSDPPSSNKVLKKGEYLELDPGKRTPILDYHPNDQDEVRRAYLVNGPTRPNMTD 101 Query: 278 YP 283 YP Sbjct: 102 YP 103 >XP_012855091.1 PREDICTED: zinc finger MYM-type protein 1-like [Erythranthe guttata] Length = 804 Score = 79.0 bits (193), Expect = 8e-14 Identities = 39/62 (62%), Positives = 44/62 (70%), Gaps = 3/62 (4%) Frame = +2 Query: 107 PNIEPSFQSPNVTFK---KGGYLESDPYKRTQILDYHPNDQDEVRRAYLVKRPTKPKLGN 277 P+ PS P +FK KG YLE DP KRT ILDYHPNDQDEVRRAYLV PT+P + + Sbjct: 42 PSSTPSSSDPPSSFKVLKKGEYLELDPGKRTPILDYHPNDQDEVRRAYLVNGPTRPNMTD 101 Query: 278 YP 283 YP Sbjct: 102 YP 103 >XP_013451349.1 hypothetical protein MTR_6g022200 [Medicago truncatula] KEH25389.1 hypothetical protein MTR_6g022200 [Medicago truncatula] Length = 128 Score = 60.8 bits (146), Expect = 9e-09 Identities = 33/95 (34%), Positives = 50/95 (52%), Gaps = 7/95 (7%) Frame = +2 Query: 95 NDIPPNIEPSFQSPNVTFKKGGYLESD-------PYKRTQILDYHPNDQDEVRRAYLVKR 253 N++ P+ + P +FK G +LE D P +R Q+ YHPN++DE+RRAYL K Sbjct: 15 NEVETTPTPTHEQPGPSFKNG-FLEVDLENLPANPRERKQLSCYHPNERDEIRRAYLAKG 73 Query: 254 PTKPKLGNYPIKVNGGF*ERSLRWWRICIAELRED 358 P +PK N+P + G F + + C+ D Sbjct: 74 PCQPKEHNFPQRPFGTFLRKGDEFLNGCLVTYESD 108 >XP_008245511.1 PREDICTED: zinc finger MYM-type protein 1-like [Prunus mume] Length = 788 Score = 56.6 bits (135), Expect = 4e-06 Identities = 34/89 (38%), Positives = 43/89 (48%) Frame = +2 Query: 23 MLRYFEPRDRFIAXXXXXXXXXXXNDIPPNIEPSFQSPNVTFKKGGYLESDPYKRTQILD 202 M R+F+ + + N+ PN S N L SDP R QIL Sbjct: 1 MERFFKRKSKSELVESSLAKSQKKNESSPNQTTEVNSEN--------LPSDPGLRNQILS 52 Query: 203 YHPNDQDEVRRAYLVKRPTKPKLGNYPIK 289 YHPN QD+VRRAYL K P +P+ N+P K Sbjct: 53 YHPNVQDQVRRAYLQKGPCQPRGHNFPYK 81