BLASTX nr result
ID: Lithospermum23_contig00028961
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00028961 (388 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012843940.1 PREDICTED: uncharacterized protein LOC105963986 [... 110 4e-26 XP_009781443.1 PREDICTED: two-component response regulator ARR12... 108 2e-25 XP_016480490.1 PREDICTED: two-component response regulator ARR12... 108 4e-25 XP_017231592.1 PREDICTED: two-component response regulator ARR18... 108 4e-25 XP_019068298.1 PREDICTED: two-component response regulator ARR14... 106 3e-24 XP_015081487.1 PREDICTED: two-component response regulator ARR14... 106 3e-24 XP_015168044.1 PREDICTED: two-component response regulator ARR14... 106 3e-24 XP_019223863.1 PREDICTED: putative two-component response regula... 101 2e-22 EYU32048.1 hypothetical protein MIMGU_mgv1a019948mg, partial [Er... 100 5e-22 XP_016475153.1 PREDICTED: two-component response regulator ARR12... 99 1e-21 XP_009598455.1 PREDICTED: two-component response regulator ARR12... 99 1e-21 XP_017233815.1 PREDICTED: two-component response regulator ARR10... 98 2e-21 EPS66755.1 hypothetical protein M569_08022, partial [Genlisea au... 91 3e-20 ONK76271.1 uncharacterized protein A4U43_C03F25870 [Asparagus of... 92 5e-20 ONK61325.1 uncharacterized protein A4U43_C08F28700 [Asparagus of... 92 7e-20 EPS65647.1 hypothetical protein M569_09127, partial [Genlisea au... 92 1e-19 XP_017233451.1 PREDICTED: two-component response regulator ARR12... 92 2e-19 XP_017614946.1 PREDICTED: two-component response regulator ARR1-... 90 3e-19 1IRZ_A Chain A, Solution Structure Of Arr10-B Belonging To The G... 84 3e-19 XP_020089717.1 two-component response regulator ARR14-like [Anan... 92 3e-19 >XP_012843940.1 PREDICTED: uncharacterized protein LOC105963986 [Erythranthe guttata] Length = 454 Score = 110 bits (276), Expect = 4e-26 Identities = 55/76 (72%), Positives = 62/76 (81%) Frame = +2 Query: 53 PAEKKPRMVWTREMHQKFLEAIEILGHEKAFPKKIVEVMGVPGLTRENIASHLQKYRMCL 232 P KKPR+VWT EMHQKFLEAIE LG+EKA PKKIVEVMGVPGLTREN+ASHLQK+R + Sbjct: 143 PVAKKPRVVWTIEMHQKFLEAIEFLGYEKAVPKKIVEVMGVPGLTRENVASHLQKFRGGM 202 Query: 233 KRYQESEPNSLHGMNQ 280 KR QE+ SL N+ Sbjct: 203 KRAQETALGSLAVRNE 218 >XP_009781443.1 PREDICTED: two-component response regulator ARR12-like [Nicotiana sylvestris] Length = 465 Score = 108 bits (271), Expect = 2e-25 Identities = 51/82 (62%), Positives = 63/82 (76%) Frame = +2 Query: 59 EKKPRMVWTREMHQKFLEAIEILGHEKAFPKKIVEVMGVPGLTRENIASHLQKYRMCLKR 238 EKK R+VWT +MHQ FL+AI+ LGHEKA PKKIVE+M PGLTRE++ASHLQKYRMC+KR Sbjct: 71 EKKRRVVWTPKMHQNFLQAIQQLGHEKAVPKKIVEIMNEPGLTREHVASHLQKYRMCIKR 130 Query: 239 YQESEPNSLHGMNQTTAVQNQC 304 QES S++ T + +C Sbjct: 131 AQESSAASIYDQILTNDAKEKC 152 >XP_016480490.1 PREDICTED: two-component response regulator ARR12-like [Nicotiana tabacum] Length = 604 Score = 108 bits (271), Expect = 4e-25 Identities = 51/82 (62%), Positives = 63/82 (76%) Frame = +2 Query: 59 EKKPRMVWTREMHQKFLEAIEILGHEKAFPKKIVEVMGVPGLTRENIASHLQKYRMCLKR 238 EKK R+VWT +MHQ FL+AI+ LGHEKA PKKIVE+M PGLTRE++ASHLQKYRMC+KR Sbjct: 210 EKKRRVVWTPKMHQNFLQAIQQLGHEKAVPKKIVEIMNEPGLTREHVASHLQKYRMCIKR 269 Query: 239 YQESEPNSLHGMNQTTAVQNQC 304 QES S++ T + +C Sbjct: 270 AQESSAASIYDQILTNDAKEKC 291 >XP_017231592.1 PREDICTED: two-component response regulator ARR18-like [Daucus carota subsp. sativus] XP_017231593.1 PREDICTED: two-component response regulator ARR18-like [Daucus carota subsp. sativus] KZN06068.1 hypothetical protein DCAR_006905 [Daucus carota subsp. sativus] Length = 628 Score = 108 bits (271), Expect = 4e-25 Identities = 50/72 (69%), Positives = 59/72 (81%) Frame = +2 Query: 62 KKPRMVWTREMHQKFLEAIEILGHEKAFPKKIVEVMGVPGLTRENIASHLQKYRMCLKRY 241 KK R++WT EMHQKFL+AIE +GH++AFPKKIVEVM VPGLTREN+ASHLQKYR+CLK+ Sbjct: 69 KKRRLIWTTEMHQKFLDAIEQIGHDRAFPKKIVEVMNVPGLTRENVASHLQKYRICLKKV 128 Query: 242 QESEPNSLHGMN 277 QE G N Sbjct: 129 QEGMDKYYWGPN 140 >XP_019068298.1 PREDICTED: two-component response regulator ARR14-like [Solanum lycopersicum] Length = 578 Score = 106 bits (264), Expect = 3e-24 Identities = 50/82 (60%), Positives = 62/82 (75%) Frame = +2 Query: 59 EKKPRMVWTREMHQKFLEAIEILGHEKAFPKKIVEVMGVPGLTRENIASHLQKYRMCLKR 238 EKK R+VWT +MHQ FL+AI+ LG+EKA PKKIVE+M PGLTRE++ASHLQKYRMC+KR Sbjct: 191 EKKRRVVWTPKMHQSFLQAIQYLGYEKAVPKKIVEIMNEPGLTREHVASHLQKYRMCIKR 250 Query: 239 YQESEPNSLHGMNQTTAVQNQC 304 QES S++ T +C Sbjct: 251 AQESSAASIYDQILTNDANAKC 272 >XP_015081487.1 PREDICTED: two-component response regulator ARR14-like [Solanum pennellii] Length = 581 Score = 106 bits (264), Expect = 3e-24 Identities = 50/82 (60%), Positives = 62/82 (75%) Frame = +2 Query: 59 EKKPRMVWTREMHQKFLEAIEILGHEKAFPKKIVEVMGVPGLTRENIASHLQKYRMCLKR 238 EKK R+VWT +MHQ FL+AI+ LG+EKA PKKIVE+M PGLTRE++ASHLQKYRMC+KR Sbjct: 191 EKKRRVVWTPKMHQSFLQAIQYLGYEKAVPKKIVEIMNEPGLTREHVASHLQKYRMCIKR 250 Query: 239 YQESEPNSLHGMNQTTAVQNQC 304 QES S++ T +C Sbjct: 251 AQESSAASIYDQILTNDANAKC 272 >XP_015168044.1 PREDICTED: two-component response regulator ARR14-like [Solanum tuberosum] Length = 598 Score = 106 bits (264), Expect = 3e-24 Identities = 50/82 (60%), Positives = 62/82 (75%) Frame = +2 Query: 59 EKKPRMVWTREMHQKFLEAIEILGHEKAFPKKIVEVMGVPGLTRENIASHLQKYRMCLKR 238 EKK R+VWT +MHQ FL+AI+ LG+EKA PKKIVE+M PGLTRE++ASHLQKYRMC+KR Sbjct: 209 EKKRRVVWTPKMHQSFLQAIQYLGYEKAVPKKIVEIMNEPGLTREHVASHLQKYRMCIKR 268 Query: 239 YQESEPNSLHGMNQTTAVQNQC 304 QES S++ T +C Sbjct: 269 AQESSAASIYDQILTNDANAKC 290 >XP_019223863.1 PREDICTED: putative two-component response regulator ARR21 [Nicotiana attenuata] Length = 619 Score = 101 bits (251), Expect = 2e-22 Identities = 52/93 (55%), Positives = 63/93 (67%), Gaps = 11/93 (11%) Frame = +2 Query: 59 EKKPRMVWTREMHQKFLEAIEILGHE-----------KAFPKKIVEVMGVPGLTRENIAS 205 EKK R+VWT +MHQ FL+AI+ LGHE KA PKKIVE+M PGLTRE++AS Sbjct: 209 EKKRRVVWTPKMHQNFLQAIQQLGHESKTVALPLFPEKAVPKKIVEIMNEPGLTREHVAS 268 Query: 206 HLQKYRMCLKRYQESEPNSLHGMNQTTAVQNQC 304 HLQKYRMCLKR QES S++ T + +C Sbjct: 269 HLQKYRMCLKRAQESSAASIYDQILTNDAKEKC 301 >EYU32048.1 hypothetical protein MIMGU_mgv1a019948mg, partial [Erythranthe guttata] Length = 464 Score = 99.8 bits (247), Expect = 5e-22 Identities = 46/56 (82%), Positives = 51/56 (91%) Frame = +2 Query: 53 PAEKKPRMVWTREMHQKFLEAIEILGHEKAFPKKIVEVMGVPGLTRENIASHLQKY 220 P KKPR+VWT EMHQKFLEAIE LG+EKA PKKIVEVMGVPGLTREN+ASHLQ++ Sbjct: 165 PVAKKPRVVWTIEMHQKFLEAIEFLGYEKAVPKKIVEVMGVPGLTRENVASHLQRF 220 >XP_016475153.1 PREDICTED: two-component response regulator ARR12-like [Nicotiana tabacum] Length = 611 Score = 99.0 bits (245), Expect = 1e-21 Identities = 51/93 (54%), Positives = 62/93 (66%), Gaps = 11/93 (11%) Frame = +2 Query: 59 EKKPRMVWTREMHQKFLEAIEILGHE-----------KAFPKKIVEVMGVPGLTRENIAS 205 EKK R+VWT +MHQ FL+AI+ LGHE KA PKKIVE+M GLTRE++AS Sbjct: 206 EKKRRVVWTPKMHQNFLQAIQQLGHESNTFALPLFPEKAVPKKIVEIMNETGLTREHVAS 265 Query: 206 HLQKYRMCLKRYQESEPNSLHGMNQTTAVQNQC 304 HLQKYRMCLKR QES S++ T + +C Sbjct: 266 HLQKYRMCLKRAQESSATSIYDQILTNDAKEKC 298 >XP_009598455.1 PREDICTED: two-component response regulator ARR12-like [Nicotiana tomentosiformis] Length = 611 Score = 99.0 bits (245), Expect = 1e-21 Identities = 51/93 (54%), Positives = 62/93 (66%), Gaps = 11/93 (11%) Frame = +2 Query: 59 EKKPRMVWTREMHQKFLEAIEILGHE-----------KAFPKKIVEVMGVPGLTRENIAS 205 EKK R+VWT +MHQ FL+AI+ LGHE KA PKKIVE+M GLTRE++AS Sbjct: 206 EKKRRVVWTPKMHQNFLQAIQQLGHESNTFALPLFPEKAVPKKIVEIMNETGLTREHVAS 265 Query: 206 HLQKYRMCLKRYQESEPNSLHGMNQTTAVQNQC 304 HLQKYRMCLKR QES S++ T + +C Sbjct: 266 HLQKYRMCLKRAQESSATSIYDQILTNDAKEKC 298 >XP_017233815.1 PREDICTED: two-component response regulator ARR10-like [Daucus carota subsp. sativus] Length = 434 Score = 97.8 bits (242), Expect = 2e-21 Identities = 45/76 (59%), Positives = 57/76 (75%) Frame = +2 Query: 59 EKKPRMVWTREMHQKFLEAIEILGHEKAFPKKIVEVMGVPGLTRENIASHLQKYRMCLKR 238 +KK R++WT EMH+KF+EAI LG ++AFPKKI+E M PGLT+ENIASHLQKYR+ LK+ Sbjct: 63 QKKTRVIWTSEMHRKFVEAIAQLGEDRAFPKKILEEMNEPGLTKENIASHLQKYRISLKK 122 Query: 239 YQESEPNSLHGMNQTT 286 QE G+N T Sbjct: 123 SQEERDGYFQGLNAAT 138 >EPS66755.1 hypothetical protein M569_08022, partial [Genlisea aurea] Length = 186 Score = 90.5 bits (223), Expect = 3e-20 Identities = 40/59 (67%), Positives = 50/59 (84%) Frame = +2 Query: 62 KKPRMVWTREMHQKFLEAIEILGHEKAFPKKIVEVMGVPGLTRENIASHLQKYRMCLKR 238 KKP++VW +H +FLEA+ ILG E+A PKKI+EVM VPGLTREN+ASHLQKYR+ L+R Sbjct: 125 KKPKLVWNNSLHNRFLEALRILGLERAVPKKILEVMNVPGLTRENVASHLQKYRIFLRR 183 >ONK76271.1 uncharacterized protein A4U43_C03F25870 [Asparagus officinalis] Length = 280 Score = 92.0 bits (227), Expect = 5e-20 Identities = 45/78 (57%), Positives = 59/78 (75%), Gaps = 6/78 (7%) Frame = +2 Query: 56 AEKKPRMVWTREMHQKFLEAIEILGHEKAFPKKIVEVMGVPGLTRENIASHLQKYRMCLK 235 + KKPR+VW+ E+HQ+F+ A+ LG EKA PK+I+E+M VPGLTREN+ASHLQK+R+ LK Sbjct: 69 SSKKPRVVWSVELHQQFVSAVSQLGIEKAVPKRILELMNVPGLTRENVASHLQKFRLYLK 128 Query: 236 R------YQESEPNSLHG 271 R +Q PNSL G Sbjct: 129 RISGVAQHQSGFPNSLCG 146 >ONK61325.1 uncharacterized protein A4U43_C08F28700 [Asparagus officinalis] Length = 306 Score = 92.0 bits (227), Expect = 7e-20 Identities = 45/78 (57%), Positives = 59/78 (75%), Gaps = 6/78 (7%) Frame = +2 Query: 56 AEKKPRMVWTREMHQKFLEAIEILGHEKAFPKKIVEVMGVPGLTRENIASHLQKYRMCLK 235 + KKPR+VW+ E+HQ+F+ A+ LG EKA PK+I+E+M VPGLTREN+ASHLQK+R+ LK Sbjct: 165 SSKKPRVVWSVELHQQFVSAVSQLGIEKAVPKRILELMNVPGLTRENVASHLQKFRLYLK 224 Query: 236 R------YQESEPNSLHG 271 R +Q PNSL G Sbjct: 225 RISGVAQHQNGFPNSLCG 242 >EPS65647.1 hypothetical protein M569_09127, partial [Genlisea aurea] Length = 353 Score = 92.0 bits (227), Expect = 1e-19 Identities = 43/72 (59%), Positives = 56/72 (77%) Frame = +2 Query: 56 AEKKPRMVWTREMHQKFLEAIEILGHEKAFPKKIVEVMGVPGLTRENIASHLQKYRMCLK 235 A KKPR+VW+ E+HQ+F+ A+ LG EKA PKKI+E+M VPGLTREN+ASHLQKYR+ L+ Sbjct: 186 ALKKPRVVWSVELHQQFVNAVNQLGIEKAVPKKILELMNVPGLTRENVASHLQKYRLYLR 245 Query: 236 RYQESEPNSLHG 271 R ++ L G Sbjct: 246 RLSVTQQGGLAG 257 >XP_017233451.1 PREDICTED: two-component response regulator ARR12-like [Daucus carota subsp. sativus] XP_017233816.1 PREDICTED: two-component response regulator ARR12-like [Daucus carota subsp. sativus] KZN05390.1 hypothetical protein DCAR_006227 [Daucus carota subsp. sativus] KZN07750.1 hypothetical protein DCAR_008587 [Daucus carota subsp. sativus] Length = 426 Score = 92.4 bits (228), Expect = 2e-19 Identities = 45/84 (53%), Positives = 62/84 (73%), Gaps = 1/84 (1%) Frame = +2 Query: 59 EKKPRMVWTREMHQKFLEAIEILGHEKAFPKKIVEVMGVPGLTRENIASHLQKYRMCLKR 238 +K+ R++WT EMH+KF+EAI LG ++AFPKKI+E M PGLT+EN+ASHLQKYR+ LK+ Sbjct: 64 QKRTRVIWTSEMHRKFVEAIAQLGEDRAFPKKILEEMNEPGLTKENVASHLQKYRLSLKK 123 Query: 239 -YQESEPNSLHGMNQTTAVQNQCL 307 ES+ N+ G +T + N L Sbjct: 124 SLVESDFNADTGSTKTPYIYNSSL 147 >XP_017614946.1 PREDICTED: two-component response regulator ARR1-like isoform X2 [Gossypium arboreum] Length = 281 Score = 90.1 bits (222), Expect = 3e-19 Identities = 39/68 (57%), Positives = 58/68 (85%) Frame = +2 Query: 62 KKPRMVWTREMHQKFLEAIEILGHEKAFPKKIVEVMGVPGLTRENIASHLQKYRMCLKRY 241 KKP+++WT E+H +FL+AI++LG E A+PKKI++VM VPGL +EN++SHLQK+R+ LKR Sbjct: 164 KKPKLIWTNELHNRFLQAIDMLGSE-AYPKKILQVMNVPGLRKENVSSHLQKHRLLLKRQ 222 Query: 242 QESEPNSL 265 QE+ N++ Sbjct: 223 QEAIQNTI 230 >1IRZ_A Chain A, Solution Structure Of Arr10-B Belonging To The Garp Family Of Plant Myb-Related Dna Binding Motifs Of The Arabidopsis Response Regulators Length = 64 Score = 84.3 bits (207), Expect = 3e-19 Identities = 37/61 (60%), Positives = 51/61 (83%) Frame = +2 Query: 56 AEKKPRMVWTREMHQKFLEAIEILGHEKAFPKKIVEVMGVPGLTRENIASHLQKYRMCLK 235 A+KKPR++WT E+H KFL A++ LG E+A PKKI+++M V LTREN+ASHLQK+R+ LK Sbjct: 2 AQKKPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVALK 61 Query: 236 R 238 + Sbjct: 62 K 62 >XP_020089717.1 two-component response regulator ARR14-like [Ananas comosus] Length = 544 Score = 92.0 bits (227), Expect = 3e-19 Identities = 44/84 (52%), Positives = 61/84 (72%), Gaps = 6/84 (7%) Frame = +2 Query: 56 AEKKPRMVWTREMHQKFLEAIEILGHEKAFPKKIVEVMGVPGLTRENIASHLQKYRMCLK 235 A KKPR+VW+ E+HQ+F+ A+ LG +KA PK+I+E+M VPGLTREN+ASHLQK+R+ L+ Sbjct: 209 ASKKPRVVWSVELHQQFVSAVNQLGIDKAVPKRILELMNVPGLTRENVASHLQKFRLYLR 268 Query: 236 R------YQESEPNSLHGMNQTTA 289 R ++ PNS G+ Q A Sbjct: 269 RLSGVTEHENGLPNSFCGLGQPNA 292