BLASTX nr result
ID: Lithospermum23_contig00028712
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00028712 (548 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY30030.1 hypothetical protein MANES_15G191700 [Manihot esculenta] 55 2e-07 YP_009231882.1 putative pvs-trna-like protein (chloroplast) [Goo... 58 4e-07 CDP55621.1 NAD(P)H-quinone oxidoreductase chain 1 [Staphylococcu... 54 8e-07 AFA27814.1 NADH-plastoquinone oxidoreductase subunit 1, partial ... 57 2e-06 KYP33032.1 hypothetical protein KK1_046166, partial [Cajanus cajan] 54 2e-06 YP_009231802.1 putative pvs-trna-like protein (chloroplast) [Goo... 55 3e-06 APU51506.1 hypothetical protein (chloroplast) [Sambucus williamsii] 55 4e-06 YP_009330745.1 hypothetical protein (chloroplast) [Viburnum util... 55 4e-06 YP_009326572.1 hypothetical protein (chloroplast) [Sinadoxa cory... 55 4e-06 YP_009320052.1 hypothetical protein (plastid) [Alniphyllum eberh... 55 4e-06 ANS80882.1 hypothetical protein (chloroplast) [Ilex szechwanensis] 55 4e-06 ANS80787.1 hypothetical protein (chloroplast) [Ilex latifolia] A... 55 4e-06 ANQ46360.1 orf188 (chloroplast) [Pogostemon cablin] 55 4e-06 YP_009262719.1 hypothetical protein (chloroplast) [Styrax grandi... 55 4e-06 ANF03950.1 hypothetical protein (plastid) [Helianthus annuus] 55 4e-06 YP_009253306.1 hypothetical protein (chloroplast) [Bruinsmia pol... 55 4e-06 AMX21815.1 orf188 (mitochondrion) [Dendrosenecio brassiciformis] 55 4e-06 AIW51887.1 NADH dehydrogenase subunit 1 (chloroplast) [Lasthenia... 55 4e-06 YP_009048167.1 hypothetical protein (chloroplast) [Primula poiss... 55 4e-06 YP_008592991.1 hypothetical protein Q731_p010 (chloroplast) [Cam... 55 4e-06 >OAY30030.1 hypothetical protein MANES_15G191700 [Manihot esculenta] Length = 42 Score = 55.1 bits (131), Expect = 2e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 546 GLRAAAQSISYEIPLTLCVLSISLRVIR 463 GLRAAAQSISYEIPLTLCVLSISLRVIR Sbjct: 15 GLRAAAQSISYEIPLTLCVLSISLRVIR 42 >YP_009231882.1 putative pvs-trna-like protein (chloroplast) [Goodyera schlechtendaliana] AMA07104.1 putative pvs-trna-like protein (chloroplast) [Goodyera schlechtendaliana] AMA07181.1 putative pvs-trna-like protein (chloroplast) [Goodyera schlechtendaliana] Length = 207 Score = 58.2 bits (139), Expect = 4e-07 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = -3 Query: 546 GLRAAAQSISYEIPLTLCVLSISLRVIR*DVKNLLFFIFIGRK 418 GLRAAAQSISYEIPLTLCVL+ISLRVIR +N+ F+ RK Sbjct: 161 GLRAAAQSISYEIPLTLCVLAISLRVIR---RNMNFYYLFSRK 200 >CDP55621.1 NAD(P)H-quinone oxidoreductase chain 1 [Staphylococcus aureus subsp. aureus] Length = 42 Score = 53.5 bits (127), Expect = 8e-07 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -3 Query: 546 GLRAAAQSISYEIPLTLCVLSISLRVIR 463 GLRAAAQSISYEIPLTLCVLSISLR IR Sbjct: 15 GLRAAAQSISYEIPLTLCVLSISLRAIR 42 >AFA27814.1 NADH-plastoquinone oxidoreductase subunit 1, partial (plastid) [Sparganium eurycarpum] Length = 395 Score = 57.4 bits (137), Expect = 2e-06 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = -3 Query: 546 GLRAAAQSISYEIPLTLCVLSISLRVIR*DVKNLLFFIFIGRK 418 GLRAAAQSISYEIPLTLCVLSISLRVIR N+ F++ G K Sbjct: 160 GLRAAAQSISYEIPLTLCVLSISLRVIR---CNMNFYLSSGNK 199 >KYP33032.1 hypothetical protein KK1_046166, partial [Cajanus cajan] Length = 88 Score = 53.5 bits (127), Expect = 2e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -3 Query: 546 GLRAAAQSISYEIPLTLCVLSISLRVIR 463 GLRAAAQSISYEIPLTLCVLSISLR IR Sbjct: 61 GLRAAAQSISYEIPLTLCVLSISLRAIR 88 >YP_009231802.1 putative pvs-trna-like protein (chloroplast) [Goodyera procera] AMA07023.1 putative pvs-trna-like protein (chloroplast) [Goodyera procera] Length = 207 Score = 55.5 bits (132), Expect = 3e-06 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = -3 Query: 546 GLRAAAQSISYEIPLTLCVLSISLRVIR*DVKNLLFFIFIGRK*NNL 406 GLRAAAQSISYEIPLTLCVL+ISLRVIR ++ N + I ++ N L Sbjct: 161 GLRAAAQSISYEIPLTLCVLAISLRVIRRNM-NFYYLFSIKKRRNEL 206 >APU51506.1 hypothetical protein (chloroplast) [Sambucus williamsii] Length = 188 Score = 55.1 bits (131), Expect = 4e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 546 GLRAAAQSISYEIPLTLCVLSISLRVIR 463 GLRAAAQSISYEIPLTLCVLSISLRVIR Sbjct: 161 GLRAAAQSISYEIPLTLCVLSISLRVIR 188 >YP_009330745.1 hypothetical protein (chloroplast) [Viburnum utile] APD79347.1 hypothetical protein (chloroplast) [Viburnum utile] Length = 188 Score = 55.1 bits (131), Expect = 4e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 546 GLRAAAQSISYEIPLTLCVLSISLRVIR 463 GLRAAAQSISYEIPLTLCVLSISLRVIR Sbjct: 161 GLRAAAQSISYEIPLTLCVLSISLRVIR 188 >YP_009326572.1 hypothetical protein (chloroplast) [Sinadoxa corydalifolia] APD52622.1 hypothetical protein (chloroplast) [Sinadoxa corydalifolia] Length = 188 Score = 55.1 bits (131), Expect = 4e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 546 GLRAAAQSISYEIPLTLCVLSISLRVIR 463 GLRAAAQSISYEIPLTLCVLSISLRVIR Sbjct: 161 GLRAAAQSISYEIPLTLCVLSISLRVIR 188 >YP_009320052.1 hypothetical protein (plastid) [Alniphyllum eberhardtii] APA19176.1 hypothetical protein (plastid) [Alniphyllum eberhardtii] Length = 188 Score = 55.1 bits (131), Expect = 4e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 546 GLRAAAQSISYEIPLTLCVLSISLRVIR 463 GLRAAAQSISYEIPLTLCVLSISLRVIR Sbjct: 161 GLRAAAQSISYEIPLTLCVLSISLRVIR 188 >ANS80882.1 hypothetical protein (chloroplast) [Ilex szechwanensis] Length = 188 Score = 55.1 bits (131), Expect = 4e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 546 GLRAAAQSISYEIPLTLCVLSISLRVIR 463 GLRAAAQSISYEIPLTLCVLSISLRVIR Sbjct: 161 GLRAAAQSISYEIPLTLCVLSISLRVIR 188 >ANS80787.1 hypothetical protein (chloroplast) [Ilex latifolia] ANS80977.1 hypothetical protein (chloroplast) [Ilex pubescens] ANS81072.1 hypothetical protein (chloroplast) [Ilex polyneura] ANS81167.1 hypothetical protein (chloroplast) [Ilex sp. XY-2016] ANS81262.1 hypothetical protein (chloroplast) [Ilex delavayi] ANS81357.1 hypothetical protein (chloroplast) [Ilex wilsonii] Length = 188 Score = 55.1 bits (131), Expect = 4e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 546 GLRAAAQSISYEIPLTLCVLSISLRVIR 463 GLRAAAQSISYEIPLTLCVLSISLRVIR Sbjct: 161 GLRAAAQSISYEIPLTLCVLSISLRVIR 188 >ANQ46360.1 orf188 (chloroplast) [Pogostemon cablin] Length = 188 Score = 55.1 bits (131), Expect = 4e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 546 GLRAAAQSISYEIPLTLCVLSISLRVIR 463 GLRAAAQSISYEIPLTLCVLSISLRVIR Sbjct: 161 GLRAAAQSISYEIPLTLCVLSISLRVIR 188 >YP_009262719.1 hypothetical protein (chloroplast) [Styrax grandiflorus] ANI87384.1 hypothetical protein (chloroplast) [Styrax grandiflorus] Length = 188 Score = 55.1 bits (131), Expect = 4e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 546 GLRAAAQSISYEIPLTLCVLSISLRVIR 463 GLRAAAQSISYEIPLTLCVLSISLRVIR Sbjct: 161 GLRAAAQSISYEIPLTLCVLSISLRVIR 188 >ANF03950.1 hypothetical protein (plastid) [Helianthus annuus] Length = 188 Score = 55.1 bits (131), Expect = 4e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 546 GLRAAAQSISYEIPLTLCVLSISLRVIR 463 GLRAAAQSISYEIPLTLCVLSISLRVIR Sbjct: 161 GLRAAAQSISYEIPLTLCVLSISLRVIR 188 >YP_009253306.1 hypothetical protein (chloroplast) [Bruinsmia polysperma] ANB78779.1 hypothetical protein (chloroplast) [Bruinsmia polysperma] Length = 188 Score = 55.1 bits (131), Expect = 4e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 546 GLRAAAQSISYEIPLTLCVLSISLRVIR 463 GLRAAAQSISYEIPLTLCVLSISLRVIR Sbjct: 161 GLRAAAQSISYEIPLTLCVLSISLRVIR 188 >AMX21815.1 orf188 (mitochondrion) [Dendrosenecio brassiciformis] Length = 188 Score = 55.1 bits (131), Expect = 4e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 546 GLRAAAQSISYEIPLTLCVLSISLRVIR 463 GLRAAAQSISYEIPLTLCVLSISLRVIR Sbjct: 161 GLRAAAQSISYEIPLTLCVLSISLRVIR 188 >AIW51887.1 NADH dehydrogenase subunit 1 (chloroplast) [Lasthenia burkei] Length = 188 Score = 55.1 bits (131), Expect = 4e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 546 GLRAAAQSISYEIPLTLCVLSISLRVIR 463 GLRAAAQSISYEIPLTLCVLSISLRVIR Sbjct: 161 GLRAAAQSISYEIPLTLCVLSISLRVIR 188 >YP_009048167.1 hypothetical protein (chloroplast) [Primula poissonii] AHF71769.1 hypothetical protein (chloroplast) [Primula poissonii] Length = 188 Score = 55.1 bits (131), Expect = 4e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 546 GLRAAAQSISYEIPLTLCVLSISLRVIR 463 GLRAAAQSISYEIPLTLCVLSISLRVIR Sbjct: 161 GLRAAAQSISYEIPLTLCVLSISLRVIR 188 >YP_008592991.1 hypothetical protein Q731_p010 (chloroplast) [Camellia impressinervis] AGU44427.1 hypothetical protein (chloroplast) [Camellia impressinervis] Length = 188 Score = 55.1 bits (131), Expect = 4e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 546 GLRAAAQSISYEIPLTLCVLSISLRVIR 463 GLRAAAQSISYEIPLTLCVLSISLRVIR Sbjct: 161 GLRAAAQSISYEIPLTLCVLSISLRVIR 188