BLASTX nr result
ID: Lithospermum23_contig00028698
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00028698 (355 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EYU30158.1 hypothetical protein MIMGU_mgv1a0115072mg, partial [E... 53 6e-06 >EYU30158.1 hypothetical protein MIMGU_mgv1a0115072mg, partial [Erythranthe guttata] Length = 198 Score = 52.8 bits (125), Expect = 6e-06 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +2 Query: 257 ISPSVENEVKLERNQNPIVVIDNYDSFTYNLCQ 355 ISPS N RN+NPIVVIDNYDSFTYNLCQ Sbjct: 60 ISPSSINSSPSGRNKNPIVVIDNYDSFTYNLCQ 92