BLASTX nr result
ID: Lithospermum23_contig00028376
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00028376 (335 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010088916.1 hypothetical protein L484_018543 [Morus notabilis... 74 1e-13 KZV35421.1 NADH dehydrogenase subunit [Dorcoceras hygrometricum] 55 9e-07 >XP_010088916.1 hypothetical protein L484_018543 [Morus notabilis] EXB37120.1 hypothetical protein L484_018543 [Morus notabilis] Length = 240 Score = 73.6 bits (179), Expect = 1e-13 Identities = 38/47 (80%), Positives = 39/47 (82%) Frame = +3 Query: 69 GSSILFSSRELPDRRSIRNGLRVHFVGRKDPGALGNPKTKSFYFIDR 209 GSSILFSS+EL DRRSIRNGLRVHFVGRKDP GNPKTK F I R Sbjct: 194 GSSILFSSQELLDRRSIRNGLRVHFVGRKDPIHSGNPKTKFFDLIHR 240 >KZV35421.1 NADH dehydrogenase subunit [Dorcoceras hygrometricum] Length = 222 Score = 55.1 bits (131), Expect = 9e-07 Identities = 32/55 (58%), Positives = 34/55 (61%) Frame = -1 Query: 248 FLRKIVISFIYLLSIYKVKRLRFGVPQSPWILSANEMNAEPVPNASPIRKFSRRE 84 F K + F YL K L F WI+SANEMNAEPVPNASPI KFSRRE Sbjct: 171 FKAKWFVCFTYLT---KGNELSFVSVFMDWIVSANEMNAEPVPNASPIWKFSRRE 222